Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NAD kinase

Gene

NADK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + NAD+ = ADP + NADP+.1 Publication

Cofactori

a divalent metal cation1 Publication

Kineticsi

  1. KM=3.3 mM for ATP1 Publication
  2. KM=0.54 mM for NAD1 Publication
  1. Vmax=6.7 µmol/min/mg enzyme1 Publication

pH dependencei

Optimum pH is 7.5.1 Publication

Temperature dependencei

Optimum temperature is 55 degrees Celsius.1 Publication

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • metal ion binding Source: UniProtKB-KW
  • NAD+ kinase activity Source: UniProtKB

GO - Biological processi

  • ATP metabolic process Source: UniProtKB
  • NAD metabolic process Source: Reactome
  • NADP biosynthetic process Source: InterPro
  • phosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Ligandi

ATP-binding, Metal-binding, NAD, NADP, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS00233-MONOMER.
ZFISH:HS00233-MONOMER.
BRENDAi2.7.1.23. 2681.
ReactomeiR-HSA-196807. Nicotinate metabolism.
SABIO-RKO95544.

Names & Taxonomyi

Protein namesi
Recommended name:
NAD kinase (EC:2.7.1.23)
Alternative name(s):
Poly(P)/ATP NAD kinase
Gene namesi
Name:NADK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:29831. NADK.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi65220.
OpenTargetsiENSG00000008130.
PharmGKBiPA142671298.

Chemistry databases

ChEMBLiCHEMBL6177.

Polymorphism and mutation databases

BioMutaiNADK.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001207131 – 446NAD kinaseAdd BLAST446

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei46PhosphoserineCombined sources1
Modified residuei48PhosphoserineCombined sources1
Modified residuei50PhosphoserineCombined sources1
Modified residuei55PhosphoserineCombined sources1
Modified residuei64PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO95544.
MaxQBiO95544.
PaxDbiO95544.
PeptideAtlasiO95544.
PRIDEiO95544.

PTM databases

iPTMnetiO95544.
PhosphoSitePlusiO95544.

Expressioni

Tissue specificityi

Widely expressed but not detected in skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000008130.
CleanExiHS_NADK.
ExpressionAtlasiO95544. baseline and differential.
GenevisibleiO95544. HS.

Organism-specific databases

HPAiHPA048909.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
LNX1Q8TBB13EBI-743949,EBI-739832
SDCBPO005605EBI-743949,EBI-727004

Protein-protein interaction databases

BioGridi122408. 15 interactors.
IntActiO95544. 10 interactors.
MINTiMINT-3296423.
STRINGi9606.ENSP00000340925.

Chemistry databases

BindingDBiO95544.

Structurei

Secondary structure

1446
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni75 – 77Combined sources3
Beta strandi78 – 80Combined sources3
Turni84 – 86Combined sources3
Beta strandi87 – 91Combined sources5
Turni93 – 95Combined sources3
Beta strandi97 – 102Combined sources6
Beta strandi106 – 111Combined sources6
Helixi116 – 118Combined sources3
Helixi119 – 131Combined sources13
Beta strandi135 – 139Combined sources5
Helixi140 – 144Combined sources5
Helixi146 – 150Combined sources5
Helixi155 – 160Combined sources6
Beta strandi162 – 164Combined sources3
Turni166 – 168Combined sources3
Turni172 – 174Combined sources3
Beta strandi176 – 183Combined sources8
Helixi186 – 193Combined sources8
Beta strandi195 – 197Combined sources3
Beta strandi201 – 208Combined sources8
Turni210 – 212Combined sources3
Beta strandi215 – 217Combined sources3
Helixi220 – 229Combined sources10
Beta strandi233 – 237Combined sources5
Beta strandi240 – 245Combined sources6
Beta strandi277 – 289Combined sources13
Beta strandi299 – 303Combined sources5
Beta strandi306 – 311Combined sources6
Beta strandi313 – 319Combined sources7
Helixi321 – 325Combined sources5
Helixi327 – 330Combined sources4
Beta strandi343 – 349Combined sources7
Beta strandi358 – 360Combined sources3
Beta strandi366 – 370Combined sources5
Beta strandi378 – 382Combined sources5
Beta strandi385 – 390Combined sources6
Beta strandi395 – 400Combined sources6
Beta strandi405 – 408Combined sources4
Helixi413 – 424Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3PFNX-ray2.70A/B/C/D68-426[»]
ProteinModelPortaliO95544.
SMRiO95544.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO95544.

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi326 – 333Poly-Ala8
Compositional biasi437 – 445Poly-Glu9

Sequence similaritiesi

Belongs to the NAD kinase family.Curated

Phylogenomic databases

eggNOGiKOG2178. Eukaryota.
COG0061. LUCA.
GeneTreeiENSGT00390000013792.
HOGENOMiHOG000176769.
HOVERGENiHBG008249.
InParanoidiO95544.
KOiK00858.
OrthoDBiEOG091G09US.
PhylomeDBiO95544.
TreeFamiTF324076.

Family and domain databases

Gene3Di2.60.200.30. 1 hit.
3.40.50.10330. 1 hit.
HAMAPiMF_00361. NAD_kinase. 1 hit.
InterProiIPR017438. ATP-NAD_kinase_dom_1.
IPR017437. ATP-NAD_kinase_PpnK-typ_all-b.
IPR016064. NAD/diacylglycerol_kinase.
IPR002504. NADK.
[Graphical view]
PANTHERiPTHR20275. PTHR20275. 2 hits.
PfamiPF01513. NAD_kinase. 1 hit.
[Graphical view]
SUPFAMiSSF111331. SSF111331. 2 hits.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95544-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEMEQEKMTM NKELSPDAAA YCCSACHGDE TWSYNHPIRG RAKSRSLSAS
60 70 80 90 100
PALGSTKEFR RTRSLHGPCP VTTFGPKACV LQNPQTIMHI QDPASQRLTW
110 120 130 140 150
NKSPKSVLVI KKMRDASLLQ PFKELCTHLM EENMIVYVEK KVLEDPAIAS
160 170 180 190 200
DESFGAVKKK FCTFREDYDD ISNQIDFIIC LGGDGTLLYA SSLFQGSVPP
210 220 230 240 250
VMAFHLGSLG FLTPFSFENF QSQVTQVIEG NAAVVLRSRL KVRVVKELRG
260 270 280 290 300
KKTAVHNGLG ENGSQAAGLD MDVGKQAMQY QVLNEVVIDR GPSSYLSNVD
310 320 330 340 350
VYLDGHLITT VQGDGVIVST PTGSTAYAAA AGASMIHPNV PAIMITPICP
360 370 380 390 400
HSLSFRPIVV PAGVELKIML SPEARNTAWV SFDGRKRQEI RHGDSISITT
410 420 430 440
SCYPLPSICV RDPVSDWFES LAQCLHWNVR KKQAHFEEEE EEEEEG
Length:446
Mass (Da):49,228
Last modified:May 1, 1999 - v1
Checksum:i48CE7AF05EDD7E8B
GO
Isoform 2 (identifier: O95544-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: M → IATPLSLASQ...AGMGVGQATG
     131-131: E → EARGAGGKGAWGAHGVGGASIHITAPRVGSAGGMSRLALCFQ

Show »
Length:591
Mass (Da):63,456
Checksum:i9F81E711739713BA
GO
Isoform 3 (identifier: O95544-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     11-87: NKELSPDAAA...ACVLQNPQTI → GRPRVRQAWP...DPTPPSNACT

Show »
Length:423
Mass (Da):46,446
Checksum:iD83B07A90D5B6D0A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti363Missing in AAG44568 (Ref. 2) Curated1
Sequence conflicti445E → EE in BAB14412 (Ref. 2) Curated1
Sequence conflicti446G → EG in BAH12420 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034119262N → K.2 PublicationsCorresponds to variant rs4751dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04731211 – 87NKELS…NPQTI → GRPRVRQAWPGCCGHTGRLP AGRGYLASHMCDPAGAELIG DGMSDPTPPSNACT in isoform 3. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_04731388M → IATPLSLASQLLPSPAVSHS GQGGVTGQVHVLPQPSDQGV LSGPRAARGQTAPQEEAVTQ EEVEALVCGHTQRWVPGPVY DAAAGGSGWAQLSLRAGMGV GQATG in isoform 2. 1 Publication1
Alternative sequenceiVSP_047314131E → EARGAGGKGAWGAHGVGGAS IHITAPRVGSAGGMSRLALC FQ in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY090771 mRNA. Translation: AAM01195.1.
AF250320 mRNA. Translation: AAG44568.1.
AK023114 mRNA. Translation: BAB14412.1.
AK290161 mRNA. Translation: BAF82850.1.
AK296722 mRNA. Translation: BAH12420.1.
AL031282 Genomic DNA. No translation available.
CH471183 Genomic DNA. Translation: EAW56151.1.
CH471183 Genomic DNA. Translation: EAW56152.1.
BC001709 mRNA. Translation: AAH01709.1.
CCDSiCCDS30565.1. [O95544-1]
CCDS55562.1. [O95544-2]
RefSeqiNP_001185922.1. NM_001198993.1. [O95544-1]
NP_001185923.1. NM_001198994.1. [O95544-2]
NP_001185924.1. NM_001198995.1.
NP_075394.3. NM_023018.4. [O95544-1]
XP_005244835.1. XM_005244778.2. [O95544-1]
XP_006710900.1. XM_006710837.2. [O95544-1]
UniGeneiHs.654792.
Hs.731532.
Hs.733075.

Genome annotation databases

EnsembliENST00000341426; ENSP00000341679; ENSG00000008130. [O95544-1]
ENST00000341991; ENSP00000344340; ENSG00000008130. [O95544-1]
ENST00000378625; ENSP00000367890; ENSG00000008130. [O95544-2]
GeneIDi65220.
KEGGihsa:65220.
UCSCiuc001aic.3. human. [O95544-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY090771 mRNA. Translation: AAM01195.1.
AF250320 mRNA. Translation: AAG44568.1.
AK023114 mRNA. Translation: BAB14412.1.
AK290161 mRNA. Translation: BAF82850.1.
AK296722 mRNA. Translation: BAH12420.1.
AL031282 Genomic DNA. No translation available.
CH471183 Genomic DNA. Translation: EAW56151.1.
CH471183 Genomic DNA. Translation: EAW56152.1.
BC001709 mRNA. Translation: AAH01709.1.
CCDSiCCDS30565.1. [O95544-1]
CCDS55562.1. [O95544-2]
RefSeqiNP_001185922.1. NM_001198993.1. [O95544-1]
NP_001185923.1. NM_001198994.1. [O95544-2]
NP_001185924.1. NM_001198995.1.
NP_075394.3. NM_023018.4. [O95544-1]
XP_005244835.1. XM_005244778.2. [O95544-1]
XP_006710900.1. XM_006710837.2. [O95544-1]
UniGeneiHs.654792.
Hs.731532.
Hs.733075.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3PFNX-ray2.70A/B/C/D68-426[»]
ProteinModelPortaliO95544.
SMRiO95544.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122408. 15 interactors.
IntActiO95544. 10 interactors.
MINTiMINT-3296423.
STRINGi9606.ENSP00000340925.

Chemistry databases

BindingDBiO95544.
ChEMBLiCHEMBL6177.

PTM databases

iPTMnetiO95544.
PhosphoSitePlusiO95544.

Polymorphism and mutation databases

BioMutaiNADK.

Proteomic databases

EPDiO95544.
MaxQBiO95544.
PaxDbiO95544.
PeptideAtlasiO95544.
PRIDEiO95544.

Protocols and materials databases

DNASUi65220.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341426; ENSP00000341679; ENSG00000008130. [O95544-1]
ENST00000341991; ENSP00000344340; ENSG00000008130. [O95544-1]
ENST00000378625; ENSP00000367890; ENSG00000008130. [O95544-2]
GeneIDi65220.
KEGGihsa:65220.
UCSCiuc001aic.3. human. [O95544-1]

Organism-specific databases

CTDi65220.
DisGeNETi65220.
GeneCardsiNADK.
HGNCiHGNC:29831. NADK.
HPAiHPA048909.
MIMi611616. gene.
neXtProtiNX_O95544.
OpenTargetsiENSG00000008130.
PharmGKBiPA142671298.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2178. Eukaryota.
COG0061. LUCA.
GeneTreeiENSGT00390000013792.
HOGENOMiHOG000176769.
HOVERGENiHBG008249.
InParanoidiO95544.
KOiK00858.
OrthoDBiEOG091G09US.
PhylomeDBiO95544.
TreeFamiTF324076.

Enzyme and pathway databases

BioCyciMetaCyc:HS00233-MONOMER.
ZFISH:HS00233-MONOMER.
BRENDAi2.7.1.23. 2681.
ReactomeiR-HSA-196807. Nicotinate metabolism.
SABIO-RKO95544.

Miscellaneous databases

ChiTaRSiNADK. human.
EvolutionaryTraceiO95544.
GeneWikiiNAD%2B_kinase.
GenomeRNAii65220.
PROiO95544.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000008130.
CleanExiHS_NADK.
ExpressionAtlasiO95544. baseline and differential.
GenevisibleiO95544. HS.

Family and domain databases

Gene3Di2.60.200.30. 1 hit.
3.40.50.10330. 1 hit.
HAMAPiMF_00361. NAD_kinase. 1 hit.
InterProiIPR017438. ATP-NAD_kinase_dom_1.
IPR017437. ATP-NAD_kinase_PpnK-typ_all-b.
IPR016064. NAD/diacylglycerol_kinase.
IPR002504. NADK.
[Graphical view]
PANTHERiPTHR20275. PTHR20275. 2 hits.
PfamiPF01513. NAD_kinase. 1 hit.
[Graphical view]
SUPFAMiSSF111331. SSF111331. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiNADK_HUMAN
AccessioniPrimary (citable) accession number: O95544
Secondary accession number(s): A6NNN3
, A8K296, B7Z434, F5GXR5, Q5QPS4, Q9H2P2, Q9H931
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: November 30, 2016
This is version 144 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.