Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NAD kinase

Gene

NADK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + NAD+ = ADP + NADP+.1 Publication

Cofactori

a divalent metal cation1 Publication

Kineticsi

  1. KM=3.3 mM for ATP1 Publication
  2. KM=0.54 mM for NAD1 Publication
  1. Vmax=6.7 µmol/min/mg enzyme1 Publication

pH dependencei

Optimum pH is 7.5.1 Publication

Temperature dependencei

Optimum temperature is 55 degrees Celsius.1 Publication

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • metal ion binding Source: UniProtKB-KW
  • NAD+ kinase activity Source: UniProtKB

GO - Biological processi

  • ATP metabolic process Source: UniProtKB
  • NAD metabolic process Source: Reactome
  • NADP biosynthetic process Source: InterPro
  • phosphorylation Source: UniProtKB

Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Metal-binding, NAD, NADP, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS00233-MONOMER
BRENDAi2.7.1.23 2681
ReactomeiR-HSA-196807 Nicotinate metabolism
SABIO-RKO95544

Names & Taxonomyi

Protein namesi
Recommended name:
NAD kinase (EC:2.7.1.23)
Alternative name(s):
Poly(P)/ATP NAD kinase
Gene namesi
Name:NADK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000008130.15
HGNCiHGNC:29831 NADK
MIMi611616 gene
neXtProtiNX_O95544

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi65220
OpenTargetsiENSG00000008130
PharmGKBiPA142671298

Chemistry databases

ChEMBLiCHEMBL6177

Polymorphism and mutation databases

BioMutaiNADK

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001207131 – 446NAD kinaseAdd BLAST446

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei46PhosphoserineCombined sources1
Modified residuei48PhosphoserineCombined sources1
Modified residuei50PhosphoserineCombined sources1
Modified residuei55PhosphoserineCombined sources1
Modified residuei64PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO95544
MaxQBiO95544
PaxDbiO95544
PeptideAtlasiO95544
PRIDEiO95544

PTM databases

iPTMnetiO95544
PhosphoSitePlusiO95544

Expressioni

Tissue specificityi

Widely expressed but not detected in skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000008130
CleanExiHS_NADK
ExpressionAtlasiO95544 baseline and differential
GenevisibleiO95544 HS

Organism-specific databases

HPAiHPA048909
HPA053368

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi122408, 66 interactors
IntActiO95544, 11 interactors
MINTiO95544
STRINGi9606.ENSP00000340925

Chemistry databases

BindingDBiO95544

Structurei

Secondary structure

1446
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni75 – 77Combined sources3
Beta strandi78 – 80Combined sources3
Turni84 – 86Combined sources3
Beta strandi87 – 91Combined sources5
Turni93 – 95Combined sources3
Beta strandi97 – 102Combined sources6
Beta strandi106 – 111Combined sources6
Helixi116 – 118Combined sources3
Helixi119 – 131Combined sources13
Beta strandi135 – 139Combined sources5
Helixi140 – 144Combined sources5
Helixi146 – 150Combined sources5
Helixi155 – 160Combined sources6
Beta strandi162 – 164Combined sources3
Turni166 – 168Combined sources3
Turni172 – 174Combined sources3
Beta strandi176 – 183Combined sources8
Helixi186 – 193Combined sources8
Beta strandi195 – 197Combined sources3
Beta strandi201 – 208Combined sources8
Turni210 – 212Combined sources3
Beta strandi215 – 217Combined sources3
Helixi220 – 229Combined sources10
Beta strandi233 – 237Combined sources5
Beta strandi240 – 245Combined sources6
Beta strandi277 – 289Combined sources13
Beta strandi299 – 303Combined sources5
Beta strandi306 – 311Combined sources6
Beta strandi313 – 319Combined sources7
Helixi321 – 325Combined sources5
Helixi327 – 330Combined sources4
Beta strandi343 – 349Combined sources7
Beta strandi358 – 360Combined sources3
Beta strandi366 – 370Combined sources5
Beta strandi378 – 382Combined sources5
Beta strandi385 – 390Combined sources6
Beta strandi395 – 400Combined sources6
Beta strandi405 – 408Combined sources4
Helixi413 – 424Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3PFNX-ray2.70A/B/C/D68-426[»]
ProteinModelPortaliO95544
SMRiO95544
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO95544

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi326 – 333Poly-Ala8
Compositional biasi437 – 445Poly-Glu9

Sequence similaritiesi

Belongs to the NAD kinase family.Curated

Phylogenomic databases

eggNOGiKOG2178 Eukaryota
COG0061 LUCA
GeneTreeiENSGT00390000013792
HOGENOMiHOG000176769
HOVERGENiHBG008249
InParanoidiO95544
KOiK00858
OrthoDBiEOG091G09US
PhylomeDBiO95544
TreeFamiTF324076

Family and domain databases

Gene3Di2.60.200.30, 1 hit
3.40.50.10330, 2 hits
HAMAPiMF_00361 NAD_kinase, 1 hit
InterProiView protein in InterPro
IPR017438 ATP-NAD_kinase_N
IPR017437 ATP-NAD_kinase_PpnK-typ_C
IPR016064 NAD/diacylglycerol_kinase_sf
IPR002504 NADK
PANTHERiPTHR20275 PTHR20275, 1 hit
PfamiView protein in Pfam
PF01513 NAD_kinase, 1 hit
SUPFAMiSSF111331 SSF111331, 2 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95544-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEMEQEKMTM NKELSPDAAA YCCSACHGDE TWSYNHPIRG RAKSRSLSAS
60 70 80 90 100
PALGSTKEFR RTRSLHGPCP VTTFGPKACV LQNPQTIMHI QDPASQRLTW
110 120 130 140 150
NKSPKSVLVI KKMRDASLLQ PFKELCTHLM EENMIVYVEK KVLEDPAIAS
160 170 180 190 200
DESFGAVKKK FCTFREDYDD ISNQIDFIIC LGGDGTLLYA SSLFQGSVPP
210 220 230 240 250
VMAFHLGSLG FLTPFSFENF QSQVTQVIEG NAAVVLRSRL KVRVVKELRG
260 270 280 290 300
KKTAVHNGLG ENGSQAAGLD MDVGKQAMQY QVLNEVVIDR GPSSYLSNVD
310 320 330 340 350
VYLDGHLITT VQGDGVIVST PTGSTAYAAA AGASMIHPNV PAIMITPICP
360 370 380 390 400
HSLSFRPIVV PAGVELKIML SPEARNTAWV SFDGRKRQEI RHGDSISITT
410 420 430 440
SCYPLPSICV RDPVSDWFES LAQCLHWNVR KKQAHFEEEE EEEEEG
Length:446
Mass (Da):49,228
Last modified:May 1, 1999 - v1
Checksum:i48CE7AF05EDD7E8B
GO
Isoform 2 (identifier: O95544-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: M → IATPLSLASQ...AGMGVGQATG
     131-131: E → EARGAGGKGAWGAHGVGGASIHITAPRVGSAGGMSRLALCFQ

Show »
Length:591
Mass (Da):63,456
Checksum:i9F81E711739713BA
GO
Isoform 3 (identifier: O95544-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     11-87: NKELSPDAAA...ACVLQNPQTI → GRPRVRQAWP...DPTPPSNACT

Show »
Length:423
Mass (Da):46,446
Checksum:iD83B07A90D5B6D0A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti363Missing in AAG44568 (Ref. 2) Curated1
Sequence conflicti445E → EE in BAB14412 (Ref. 2) Curated1
Sequence conflicti446G → EG in BAH12420 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034119262N → K2 PublicationsCorresponds to variant dbSNP:rs4751Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04731211 – 87NKELS…NPQTI → GRPRVRQAWPGCCGHTGRLP AGRGYLASHMCDPAGAELIG DGMSDPTPPSNACT in isoform 3. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_04731388M → IATPLSLASQLLPSPAVSHS GQGGVTGQVHVLPQPSDQGV LSGPRAARGQTAPQEEAVTQ EEVEALVCGHTQRWVPGPVY DAAAGGSGWAQLSLRAGMGV GQATG in isoform 2. 1 Publication1
Alternative sequenceiVSP_047314131E → EARGAGGKGAWGAHGVGGAS IHITAPRVGSAGGMSRLALC FQ in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY090771 mRNA Translation: AAM01195.1
AF250320 mRNA Translation: AAG44568.1
AK023114 mRNA Translation: BAB14412.1
AK290161 mRNA Translation: BAF82850.1
AK296722 mRNA Translation: BAH12420.1
AL031282 Genomic DNA No translation available.
CH471183 Genomic DNA Translation: EAW56151.1
CH471183 Genomic DNA Translation: EAW56152.1
BC001709 mRNA Translation: AAH01709.1
CCDSiCCDS30565.1 [O95544-1]
CCDS55562.1 [O95544-2]
RefSeqiNP_001185922.1, NM_001198993.1 [O95544-1]
NP_001185923.1, NM_001198994.1 [O95544-2]
NP_001185924.1, NM_001198995.1
NP_075394.3, NM_023018.4 [O95544-1]
XP_005244835.1, XM_005244778.2
XP_006710900.1, XM_006710837.2 [O95544-1]
UniGeneiHs.654792
Hs.731532
Hs.733075

Genome annotation databases

EnsembliENST00000341426; ENSP00000341679; ENSG00000008130 [O95544-1]
ENST00000341991; ENSP00000344340; ENSG00000008130 [O95544-1]
ENST00000378625; ENSP00000367890; ENSG00000008130 [O95544-2]
GeneIDi65220
KEGGihsa:65220
UCSCiuc001aic.3 human [O95544-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiNADK_HUMAN
AccessioniPrimary (citable) accession number: O95544
Secondary accession number(s): A6NNN3
, A8K296, B7Z434, F5GXR5, Q5QPS4, Q9H2P2, Q9H931
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: May 23, 2018
This is version 154 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health