O95466 (FMNL_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Formin-like protein 1 Alternative name(s): CLL-associated antigen KW-13 Leukocyte formin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1100 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in the control of cell motility and survival of macrophages By similarity. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape. Ref.13 |
| Subunit structure | Interacts with RAC1, PFN1 and PFN2 By similarity. Interacts (activated by RAC1) with SRGAP2 (via SH3 domain); regulates the actin filament severing activity of FMNL1. Ref.15 |
| Subcellular location | Cytoplasm By similarity. Cell membrane; Lipid-anchor. Cytoplasmic vesicle › phagosome By similarity. Note: Recruited to actin-rich phagosomes during phagocytosis. Translocates to the plasma membrane upon activation by RAC1 By similarity. Ref.7 Isoform 3: Cytoplasm › cell cortex. Cell projection › bleb. Note: Colocalized with F-actin in bleb protrusions. Ref.7 |
| Tissue specificity | Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. |
| Domain | The DAD domain regulates activation via by an autoinhibitory interaction with the N-terminus. This autoinhibition is released upon competitive binding of an activated GTPase. The release of DAD allows the FH2 domain to then nucleate and elongate nonbranched actin filaments By similarity. |
| Post-translational modification | Myristoylation mediates membrane localization and blebbing. |
| Sequence similarities | Belongs to the formin homology family. Contains 1 DAD (diaphanous autoregulatory) domain. Contains 1 FH2 (formin homology 2) domain. Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain. |
| Sequence caution | The sequence AAH21906.1 differs from that shown. Reason: Erroneous initiation. The sequence CAA07870.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| SRGAP2 | O75044 | 3 | EBI-720020,EBI-1051034 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O95466-1) Also known as: FMNL1alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O95466-2) Also known as: FMNL1beta; The sequence of this isoform differs from the canonical sequence as follows: 1071-1100: VIKTVPFTARTGKRTSRLLCEASLGEEMPL → DLRNQPYIRADTGRRSARRRPPGPPLQVTSDLSL | ||||||
| Isoform 3 (identifier: O95466-3) Also known as: FMNL1gamma; The sequence of this isoform differs from the canonical sequence as follows: 1070-1070: T → TGKGLARPWSYPQSVLLCFLLTQCAILWGTGCHTASCYLFCFSFLFPFSTPLHLPHPHS | ||||||
| Note: Due to intron retention. Constitutively activated form, probably due to alterations in the DAD domain. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1100 | 1100 | Formin-like protein 1 | PRO_0000194890 | |||||
Regions | |||||||||
| Domain | 27 – 468 | 442 | GBD/FH3 | ||||||
| Domain | 632 – 1023 | 392 | FH2 | ||||||
| Domain | 1059 – 1090 | 32 | DAD | ||||||
| Compositional bias | 459 – 616 | 158 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 7 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 184 | 1 | Phosphoserine Ref.9 Ref.11 Ref.12 | ||||||
| Modified residue | 624 | 1 | Phosphoserine Ref.8 Ref.9 Ref.11 Ref.12 | ||||||
| Lipidation | 2 | 1 | N-myristoyl glycine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1070 | 1 | T → TGKGLARPWSYPQSVLLCFL LTQCAILWGTGCHTASCYLF CFSFLFPFSTPLHLPHPHS in isoform 3. | VSP_043845 | |||||
| Alternative sequence | 1071 – 1100 | 30 | VIKTV…EEMPL → DLRNQPYIRADTGRRSARRR PPGPPLQVTSDLSL in isoform 2. | VSP_013977 | |||||
Experimental info | |||||||||
| Sequence conflict | 455 | 1 | P → A in AAP32476. Ref.1 | ||||||
| Sequence conflict | 455 | 1 | P → A in AAL99920. Ref.3 | ||||||
| Sequence conflict | 455 | 1 | P → A in AAH73988. Ref.4 | ||||||
| Sequence conflict | 602 | 1 | Missing in AAH21906. Ref.4 | ||||||
| Sequence conflict | 629 | 1 | G → R in CAA07870. Ref.5 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 1101 – 1102 | 2 | DL → EV in AAH21906. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human leukocyte formin: a new protein preferentially expressed in lymphocytes." Favaro P.M.B., Medina S.S., Basseres D.S., Costa F.F., Saad S.T.O. Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Bone marrow. |
| [2] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "Identification of novel tumor antigens in CLL by SEREX: assessment of their potential as targets for immunotherapeutic approaches." Krackhardt A.M., Witzens M., Harig S., Hodi F.S., Zauls A.J., Chessia M., Barrett P., Gribben J.G. Submitted (OCT-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 110-1100 (ISOFORM 1). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 419-1100 (ISOFORMS 1 AND 2). Tissue: Brain and Lymph. |
| [5] | "The NIK protein kinase and C17orf1 genes: chromosomal mapping, gene structures and mutational screening in frontotemporal dementia and parkinsonism linked to chromosome 17." Aronsson F.C., Magnusson P., Andersson B., Karsten S.L., Shibasaki Y., Lendon C.L., Goate A.M., Brookes A.J. Hum. Genet. 103:340-345(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 629-1100 (ISOFORM 2). |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 642-1100 (ISOFORM 2). |
| [7] | "Formin-like 1 (FMNL1) is regulated by N-terminal myristoylation and induces polarized membrane blebbing." Han Y., Eppinger E., Schuster I.G., Weigand L.U., Liang X., Kremmer E., Peschel C., Krackhardt A.M. J. Biol. Chem. 284:33409-33417(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 668-1100 (ISOFORM 3), MYRISTOYLATION AT GLY-2, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING. |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-624, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment." Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. J. Proteome Res. 7:5167-5176(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-184 AND SER-624, MASS SPECTROMETRY. Tissue: T-cell. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-7; SER-184 AND SER-624, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [12] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-184 AND SER-624, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Identification and characterization of a set of conserved and new regulators of cytoskeletal organisation, cell morphology and migration." Bai S.W., Herrera-Abreu M.T., Rohn J.L., Racine V., Tajadura V., Suryavanshi N., Bechtel S., Wiemann S., Baum B., Ridley A.J. BMC Biol. 9:54-54(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "Bi-modal regulation of a formin by srGAP2." Mason F.M., Heimsath E.G., Higgs H.N., Soderling S.H. J. Biol. Chem. 286:6577-6586(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SRGAP2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY278319 mRNA. Translation: AAP32476.1. AC008105 mRNA. No translation available. AF432213 mRNA. Translation: AAL99920.1. BC001710 mRNA. Translation: AAH01710.2. BC009000 mRNA. Translation: AAH09000.2. BC021906 mRNA. Translation: AAH21906.1. Different initiation. BC073988 mRNA. Translation: AAH73988.1. AJ008112 mRNA. Translation: CAA07870.1. Different initiation. CR456759 mRNA. Translation: CAG33040.1. FJ534522 mRNA. Translation: ACR19333.1. |
| IPI | IPI00025202. IPI00163516. IPI00954929. |
| RefSeq | NP_005883.2. NM_005892.3. |
| UniGene | Hs.100217. |
3D structure databases | |
| ProteinModelPortal | O95466. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O95466. 3 interactions. |
| MINT | MINT-1188250. |
| STRING | 9606.ENSP00000329219. |
PTM databases | |
| PhosphoSite | O95466. |
Proteomic databases | |
| PaxDb | O95466. |
| PRIDE | O95466. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000328118; ENSP00000327442; ENSG00000184922. ENST00000331495; ENSP00000329219; ENSG00000184922. |
| GeneID | 752. |
| KEGG | hsa:752. |
| UCSC | uc002iin.3. human. uc002iiq.3. human. |
Organism-specific databases | |
| CTD | 752. |
| GeneCards | GC17P043299. |
| HGNC | HGNC:1212. FMNL1. |
| HPA | HPA008129. HPA028288. |
| MIM | 604656. gene. |
| neXtProt | NX_O95466. |
| PharmGKB | PA28186. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG149898. |
| HOVERGEN | HBG053118. |
| OMA | QLTGFHS. |
| PhylomeDB | O95466. |
Gene expression databases | |
| Bgee | O95466. |
| CleanEx | HS_FMNL1. |
| Genevestigator | O95466. |
| GermOnline | ENSG00000184922. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003104. Actin-bd_FH2/DRF_autoreg. IPR016024. ARM-type_fold. IPR014767. Diaphanous_autoregulatory. IPR010472. Drf_FH3. IPR010473. Drf_GTPase-bd. IPR015425. FH2_actin-bd. IPR014768. GTPase-bd/formin_homology_3. [Graphical view] |
| Pfam | PF06367. Drf_FH3. 1 hit. PF06371. Drf_GBD. 2 hits. PF02181. FH2. 1 hit. [Graphical view] |
| SMART | SM00498. FH2. 1 hit. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. SSF101447. FH2_actin_bd. 1 hit. |
| PROSITE | PS51231. DAD. 1 hit. PS51444. FH2. 1 hit. PS51232. GBD_FH3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 752. |
| NextBio | 3034. |
| SOURCE | Search... |
Entry information
| Entry name | FMNL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95466 Secondary accession number(s): D2DGW2 Q96H10 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
