Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O95399 (UTS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 110. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Urotensin-2
Alternative name(s):
Urotensin II
Short name=U-II
Short name=UII
Gene names
Name:UTS2
ORF Names:UNQ525/PRO1068
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length124 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Highly potent vasoconstrictor.

Subcellular location

Secreted.

Tissue specificity

Brain specific.

Sequence similarities

Belongs to the urotensin-2 family.

Ontologies

Keywords
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSignal
   Molecular functionHormone
   PTMCleavage on pair of basic residues
Disulfide bond
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processmuscle contraction

Traceable author statement Ref.2. Source: ProtInc

negative regulation of blood pressure

Inferred from electronic annotation. Source: Ensembl

negative regulation of glomerular filtration

Inferred from electronic annotation. Source: Ensembl

negative regulation of heart rate

Inferred from electronic annotation. Source: Ensembl

negative regulation of insulin secretion

Inferred from electronic annotation. Source: Ensembl

negative regulation of renal sodium excretion

Inferred from electronic annotation. Source: Ensembl

negative regulation of urine volume

Inferred from electronic annotation. Source: Ensembl

positive regulation of angiogenesis

Inferred from electronic annotation. Source: Ensembl

positive regulation of blood pressure

Inferred from electronic annotation. Source: Ensembl

positive regulation of cell differentiation

Inferred from electronic annotation. Source: Ensembl

positive regulation of circadian sleep/wake cycle, REM sleep

Inferred from electronic annotation. Source: Ensembl

positive regulation of circadian sleep/wake cycle, wakefulness

Inferred from electronic annotation. Source: Ensembl

positive regulation of collagen biosynthetic process

Inferred from electronic annotation. Source: Ensembl

positive regulation of cytosolic calcium ion concentration

Inferred from electronic annotation. Source: Ensembl

positive regulation of fibroblast migration

Inferred from electronic annotation. Source: Ensembl

positive regulation of fibroblast proliferation

Inferred from electronic annotation. Source: Ensembl

positive regulation of heart rate

Inferred from electronic annotation. Source: Ensembl

positive regulation of synaptic transmission, cholinergic

Inferred from electronic annotation. Source: Ensembl

positive regulation of vasodilation

Inferred from electronic annotation. Source: Ensembl

regulation of blood pressure

Traceable author statement Ref.2. Source: ProtInc

response to drug

Inferred from electronic annotation. Source: Ensembl

response to hypoxia

Inferred from electronic annotation. Source: Ensembl

response to testosterone

Inferred from electronic annotation. Source: Ensembl

synaptic transmission

Traceable author statement Ref.2. Source: ProtInc

   Cellular_componentextracellular region

Traceable author statement. Source: Reactome

extracellular space

Traceable author statement Ref.2. Source: ProtInc

   Molecular_functionhormone activity

Traceable author statement Ref.2. Source: ProtInc

receptor binding

Traceable author statement Ref.2. Source: ProtInc

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O95399-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O95399-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MYKLASCCLLFIGFLNPLLSLPLLDSR → METNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLL
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2020 Ref.5
Propeptide21 – 11090
PRO_0000036346
Peptide114 – 12411Urotensin-2
PRO_0000036347

Amino acid modifications

Disulfide bond118 ↔ 123 By similarity

Natural variations

Alternative sequence1 – 2727MYKLA…LLDSR → METNVFHLMLCVTSARTHKS TSLCFGHFNSYPSLPLIHDL LL in isoform 2.
VSP_013638
Natural variant121I → T. Ref.3
Corresponds to variant rs34305100 [ dbSNP | Ensembl ].
VAR_053734
Natural variant741S → N.
Corresponds to variant rs2890565 [ dbSNP | Ensembl ].
VAR_029313

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 1999. Version 1.
Checksum: C7A5FC7EFE00D312

FASTA12414,296
        10         20         30         40         50         60 
MYKLASCCLL FIGFLNPLLS LPLLDSREIS FQLSAPHEDA RLTPEELERA SLLQILPEML 

        70         80         90        100        110        120 
GAERGDILRK ADSSTNIFNP RGNLRKFQDF SGQDPNILLS HLLARIWKPY KKRETPDCFW 


KYCV 

« Hide

Isoform 2 [UniParc].

Checksum: 8E8FFEF916A105BD
Show »

FASTA13916,029

References

« Hide 'large scale' references
[1]"Cloning of the cDNA encoding the urotensin II precursor in frog and human reveals intense expression of the urotensin II gene in motoneurons of the spinal cord."
Coulouarn Y., Lihrmann I., Jegou S., Anouar Y., Tostivint H., Beauvillain J.-C., Conlon J.M., Bern H.A., Vaudry H.
Proc. Natl. Acad. Sci. U.S.A. 95:15803-15808(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Spinal cord.
[2]"Human urotensin-II is a potent vasoconstrictor and agonist for the orphan receptor GPR14."
Ames R.S., Sarau H.M., Chambers J.K., Willette R.N., Aiyar N.V., Romanic A.M., Louden C.S., Foley J.J., Sauermelch C.F., Coatney R.W., Ao Z., Disa J., Holmes S.D., Stadel J.M., Martin J.D., Liu W.-S., Glover G.I., Wilson S. expand/collapse author list , McNulty D.E., Ellis C.E., Elshourbagy N.A., Shabon U., Trill J.J., Hay D.W.P., Ohlstein E.H., Bergsma D.J., Douglas S.A.
Nature 401:282-286(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[3]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-12.
[4]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"Signal peptide prediction based on analysis of experimentally verified cleavage sites."
Zhang Z., Henzel W.J.
Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 21-35 (ISOFORM 1).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF104118 mRNA. Translation: AAD13070.1.
AF140630 mRNA. Translation: AAD55577.1.
AY358375 mRNA. Translation: AAQ88741.1.
Z98884 Genomic DNA. Translation: CAB63148.1.
Z98884 Genomic DNA. Translation: CAI21438.1.
RefSeqNP_006777.1. NM_006786.3.
NP_068835.1. NM_021995.2.
UniGeneHs.715862.

3D structure databases

ProteinModelPortalO95399.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116116. 1 interaction.
STRING9606.ENSP00000054668.

Chemistry

BindingDBO95399.
ChEMBLCHEMBL6165.

PTM databases

PhosphoSiteO95399.

Proteomic databases

PaxDbO95399.
PRIDEO95399.

Protocols and materials databases

DNASU10911.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000054668; ENSP00000054668; ENSG00000049247. [O95399-2]
ENST00000361696; ENSP00000355163; ENSG00000049247. [O95399-1]
GeneID10911.
KEGGhsa:10911.
UCSCuc001aor.3. human. [O95399-1]
uc001aos.3. human. [O95399-2]

Organism-specific databases

CTD10911.
GeneCardsGC01M007904.
HGNCHGNC:12636. UTS2.
HPAHPA017000.
MIM604097. gene.
neXtProtNX_O95399.
PharmGKBPA37261.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG298147.
HOGENOMHOG000136847.
HOVERGENHBG065793.
KOK05248.
OMAGNLSECF.
PhylomeDBO95399.
TreeFamTF330799.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

ArrayExpressO95399.
BgeeO95399.
CleanExHS_UTS2.
GenevestigatorO95399.

Family and domain databases

InterProIPR001483. Urotensin_II.
[Graphical view]
PfamPF02083. Urotensin_II. 1 hit.
[Graphical view]
PROSITEPS00984. UROTENSIN_II. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiUTS2.
GenomeRNAi10911.
NextBio41439.
PROO95399.
SOURCESearch...

Entry information

Entry nameUTS2_HUMAN
AccessionPrimary (citable) accession number: O95399
Secondary accession number(s): Q5H8X7, Q6UXF6, Q9UKP7
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 1999
Last modified: April 16, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM