SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O95399

- UTS2_HUMAN

UniProt

O95399 - UTS2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Urotensin-2
Gene
UTS2, UNQ525/PRO1068
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Highly potent vasoconstrictor.

GO - Molecular functioni

  1. hormone activity Source: ProtInc
  2. receptor binding Source: ProtInc
Complete GO annotation...

GO - Biological processi

  1. muscle contraction Source: ProtInc
  2. negative regulation of blood pressure Source: Ensembl
  3. negative regulation of glomerular filtration Source: Ensembl
  4. negative regulation of heart rate Source: Ensembl
  5. negative regulation of insulin secretion Source: Ensembl
  6. negative regulation of renal sodium excretion Source: Ensembl
  7. negative regulation of urine volume Source: Ensembl
  8. positive regulation of angiogenesis Source: Ensembl
  9. positive regulation of blood pressure Source: Ensembl
  10. positive regulation of cell differentiation Source: Ensembl
  11. positive regulation of circadian sleep/wake cycle, REM sleep Source: Ensembl
  12. positive regulation of circadian sleep/wake cycle, wakefulness Source: Ensembl
  13. positive regulation of collagen biosynthetic process Source: Ensembl
  14. positive regulation of cytosolic calcium ion concentration Source: Ensembl
  15. positive regulation of fibroblast migration Source: Ensembl
  16. positive regulation of fibroblast proliferation Source: Ensembl
  17. positive regulation of heart rate Source: Ensembl
  18. positive regulation of synaptic transmission, cholinergic Source: Ensembl
  19. positive regulation of vasodilation Source: Ensembl
  20. regulation of blood pressure Source: ProtInc
  21. response to drug Source: Ensembl
  22. response to hypoxia Source: Ensembl
  23. response to testosterone Source: Ensembl
  24. synaptic transmission Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hormone

Enzyme and pathway databases

ReactomeiREACT_14819. Peptide ligand-binding receptors.
REACT_18283. G alpha (q) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Urotensin-2
Alternative name(s):
Urotensin II
Short name:
U-II
Short name:
UII
Gene namesi
Name:UTS2
ORF Names:UNQ525/PRO1068
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:12636. UTS2.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: Reactome
  2. extracellular space Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37261.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 20201 Publication
Add
BLAST
Propeptidei21 – 11090
PRO_0000036346Add
BLAST
Peptidei114 – 12411Urotensin-2
PRO_0000036347Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi118 ↔ 123 By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond

Proteomic databases

MaxQBiO95399.
PaxDbiO95399.
PRIDEiO95399.

PTM databases

PhosphoSiteiO95399.

Expressioni

Tissue specificityi

Brain specific.

Gene expression databases

ArrayExpressiO95399.
BgeeiO95399.
CleanExiHS_UTS2.
GenevestigatoriO95399.

Organism-specific databases

HPAiHPA017000.

Interactioni

Protein-protein interaction databases

BioGridi116116. 1 interaction.
STRINGi9606.ENSP00000054668.

Structurei

3D structure databases

ProteinModelPortaliO95399.

Family & Domainsi

Sequence similaritiesi

Belongs to the urotensin-2 family.

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG298147.
HOGENOMiHOG000136847.
HOVERGENiHBG065793.
KOiK05248.
OMAiKDRKQYK.
PhylomeDBiO95399.
TreeFamiTF330799.

Family and domain databases

InterProiIPR001483. Urotensin_II.
[Graphical view]
PfamiPF02083. Urotensin_II. 1 hit.
[Graphical view]
PROSITEiPS00984. UROTENSIN_II. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O95399-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MYKLASCCLL FIGFLNPLLS LPLLDSREIS FQLSAPHEDA RLTPEELERA    50
SLLQILPEML GAERGDILRK ADSSTNIFNP RGNLRKFQDF SGQDPNILLS 100
HLLARIWKPY KKRETPDCFW KYCV 124
Length:124
Mass (Da):14,296
Last modified:May 1, 1999 - v1
Checksum:iC7A5FC7EFE00D312
GO
Isoform 2 (identifier: O95399-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MYKLASCCLLFIGFLNPLLSLPLLDSR → METNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLL

Note: No experimental confirmation available.

Show »
Length:139
Mass (Da):16,029
Checksum:i8E8FFEF916A105BD
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti12 – 121I → T.1 Publication
Corresponds to variant rs34305100 [ dbSNP | Ensembl ].
VAR_053734
Natural varianti74 – 741S → N.
Corresponds to variant rs2890565 [ dbSNP | Ensembl ].
VAR_029313

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2727MYKLA…LLDSR → METNVFHLMLCVTSARTHKS TSLCFGHFNSYPSLPLIHDL LL in isoform 2.
VSP_013638Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF104118 mRNA. Translation: AAD13070.1.
AF140630 mRNA. Translation: AAD55577.1.
AY358375 mRNA. Translation: AAQ88741.1.
Z98884 Genomic DNA. Translation: CAB63148.1.
Z98884 Genomic DNA. Translation: CAI21438.1.
CCDSiCCDS90.1. [O95399-2]
CCDS91.1. [O95399-1]
RefSeqiNP_006777.1. NM_006786.3. [O95399-1]
NP_068835.1. NM_021995.2. [O95399-2]
UniGeneiHs.715862.

Genome annotation databases

EnsembliENST00000054668; ENSP00000054668; ENSG00000049247. [O95399-2]
ENST00000361696; ENSP00000355163; ENSG00000049247. [O95399-1]
GeneIDi10911.
KEGGihsa:10911.
UCSCiuc001aor.3. human. [O95399-1]
uc001aos.3. human. [O95399-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF104118 mRNA. Translation: AAD13070.1 .
AF140630 mRNA. Translation: AAD55577.1 .
AY358375 mRNA. Translation: AAQ88741.1 .
Z98884 Genomic DNA. Translation: CAB63148.1 .
Z98884 Genomic DNA. Translation: CAI21438.1 .
CCDSi CCDS90.1. [O95399-2 ]
CCDS91.1. [O95399-1 ]
RefSeqi NP_006777.1. NM_006786.3. [O95399-1 ]
NP_068835.1. NM_021995.2. [O95399-2 ]
UniGenei Hs.715862.

3D structure databases

ProteinModelPortali O95399.
ModBasei Search...

Protein-protein interaction databases

BioGridi 116116. 1 interaction.
STRINGi 9606.ENSP00000054668.

Chemistry

BindingDBi O95399.
ChEMBLi CHEMBL6165.

PTM databases

PhosphoSitei O95399.

Proteomic databases

MaxQBi O95399.
PaxDbi O95399.
PRIDEi O95399.

Protocols and materials databases

DNASUi 10911.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000054668 ; ENSP00000054668 ; ENSG00000049247 . [O95399-2 ]
ENST00000361696 ; ENSP00000355163 ; ENSG00000049247 . [O95399-1 ]
GeneIDi 10911.
KEGGi hsa:10911.
UCSCi uc001aor.3. human. [O95399-1 ]
uc001aos.3. human. [O95399-2 ]

Organism-specific databases

CTDi 10911.
GeneCardsi GC01M007904.
HGNCi HGNC:12636. UTS2.
HPAi HPA017000.
MIMi 604097. gene.
neXtProti NX_O95399.
PharmGKBi PA37261.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG298147.
HOGENOMi HOG000136847.
HOVERGENi HBG065793.
KOi K05248.
OMAi KDRKQYK.
PhylomeDBi O95399.
TreeFami TF330799.

Enzyme and pathway databases

Reactomei REACT_14819. Peptide ligand-binding receptors.
REACT_18283. G alpha (q) signalling events.

Miscellaneous databases

GeneWikii UTS2.
GenomeRNAii 10911.
NextBioi 41439.
PROi O95399.
SOURCEi Search...

Gene expression databases

ArrayExpressi O95399.
Bgeei O95399.
CleanExi HS_UTS2.
Genevestigatori O95399.

Family and domain databases

InterProi IPR001483. Urotensin_II.
[Graphical view ]
Pfami PF02083. Urotensin_II. 1 hit.
[Graphical view ]
PROSITEi PS00984. UROTENSIN_II. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of the cDNA encoding the urotensin II precursor in frog and human reveals intense expression of the urotensin II gene in motoneurons of the spinal cord."
    Coulouarn Y., Lihrmann I., Jegou S., Anouar Y., Tostivint H., Beauvillain J.-C., Conlon J.M., Bern H.A., Vaudry H.
    Proc. Natl. Acad. Sci. U.S.A. 95:15803-15808(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Spinal cord.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-12.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
    Zhang Z., Henzel W.J.
    Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 21-35 (ISOFORM 1).

Entry informationi

Entry nameiUTS2_HUMAN
AccessioniPrimary (citable) accession number: O95399
Secondary accession number(s): Q5H8X7, Q6UXF6, Q9UKP7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 1999
Last modified: September 3, 2014
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi