Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Urotensin-2

Gene

UTS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Highly potent vasoconstrictor.

GO - Molecular functioni

  • hormone activity Source: ProtInc
  • receptor binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hormone

Enzyme and pathway databases

BioCyciZFISH:ENSG00000049247-MONOMER.
ReactomeiR-HSA-375276. Peptide ligand-binding receptors.
R-HSA-416476. G alpha (q) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Urotensin-2
Alternative name(s):
Urotensin II
Short name:
U-II
Short name:
UII
Gene namesi
Name:UTS2
ORF Names:UNQ525/PRO1068
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:12636. UTS2.

Subcellular locationi

GO - Cellular componenti

  • cell Source: GOC
  • extracellular region Source: Reactome
  • extracellular space Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi10911.
OpenTargetsiENSG00000049247.
PharmGKBiPA37261.

Chemistry databases

ChEMBLiCHEMBL6165.

Polymorphism and mutation databases

BioMutaiUTS2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Add BLAST20
PropeptideiPRO_000003634621 – 110Add BLAST90
PeptideiPRO_0000036347114 – 124Urotensin-2Add BLAST11

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi118 ↔ 123By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond

Proteomic databases

EPDiO95399.
MaxQBiO95399.
PeptideAtlasiO95399.
PRIDEiO95399.

Expressioni

Tissue specificityi

Brain specific.

Gene expression databases

BgeeiENSG00000049247.
CleanExiHS_UTS2.
ExpressionAtlasiO95399. baseline and differential.
GenevisibleiO95399. HS.

Organism-specific databases

HPAiHPA017000.

Interactioni

GO - Molecular functioni

  • hormone activity Source: ProtInc
  • receptor binding Source: ProtInc

Protein-protein interaction databases

BioGridi116116. 2 interactors.
IntActiO95399. 1 interactor.

Chemistry databases

BindingDBiO95399.

Structurei

3D structure databases

ProteinModelPortaliO95399.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the urotensin-2 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

GeneTreeiENSGT00510000049583.
HOGENOMiHOG000136847.
HOVERGENiHBG065793.
InParanoidiO95399.
KOiK05248.
OMAiCPLFSLP.
OrthoDBiEOG091G12LI.
PhylomeDBiO95399.
TreeFamiTF330799.

Family and domain databases

InterProiIPR001483. Urotensin_II.
[Graphical view]
PfamiPF02083. Urotensin_II. 1 hit.
[Graphical view]
PROSITEiPS00984. UROTENSIN_II. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95399-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYKLASCCLL FIGFLNPLLS LPLLDSREIS FQLSAPHEDA RLTPEELERA
60 70 80 90 100
SLLQILPEML GAERGDILRK ADSSTNIFNP RGNLRKFQDF SGQDPNILLS
110 120
HLLARIWKPY KKRETPDCFW KYCV
Length:124
Mass (Da):14,296
Last modified:May 1, 1999 - v1
Checksum:iC7A5FC7EFE00D312
GO
Isoform 2 (identifier: O95399-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MYKLASCCLLFIGFLNPLLSLPLLDSR → METNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLL

Note: No experimental confirmation available.
Show »
Length:139
Mass (Da):16,029
Checksum:i8E8FFEF916A105BD
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05373412I → T.1 PublicationCorresponds to variant rs34305100dbSNPEnsembl.1
Natural variantiVAR_02931374S → N.Corresponds to variant rs2890565dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0136381 – 27MYKLA…LLDSR → METNVFHLMLCVTSARTHKS TSLCFGHFNSYPSLPLIHDL LL in isoform 2. 1 PublicationAdd BLAST27

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF104118 mRNA. Translation: AAD13070.1.
AF140630 mRNA. Translation: AAD55577.1.
AY358375 mRNA. Translation: AAQ88741.1.
Z98884 Genomic DNA. Translation: CAB63148.1.
Z98884 Genomic DNA. Translation: CAI21438.1.
CCDSiCCDS90.1. [O95399-2]
CCDS91.1. [O95399-1]
RefSeqiNP_006777.1. NM_006786.3. [O95399-1]
NP_068835.1. NM_021995.2. [O95399-2]
XP_011538839.1. XM_011540537.2. [O95399-2]
XP_011538840.1. XM_011540538.1. [O95399-1]
UniGeneiHs.715862.

Genome annotation databases

EnsembliENST00000054668; ENSP00000054668; ENSG00000049247. [O95399-2]
ENST00000361696; ENSP00000355163; ENSG00000049247. [O95399-1]
GeneIDi10911.
KEGGihsa:10911.
UCSCiuc001aor.4. human. [O95399-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF104118 mRNA. Translation: AAD13070.1.
AF140630 mRNA. Translation: AAD55577.1.
AY358375 mRNA. Translation: AAQ88741.1.
Z98884 Genomic DNA. Translation: CAB63148.1.
Z98884 Genomic DNA. Translation: CAI21438.1.
CCDSiCCDS90.1. [O95399-2]
CCDS91.1. [O95399-1]
RefSeqiNP_006777.1. NM_006786.3. [O95399-1]
NP_068835.1. NM_021995.2. [O95399-2]
XP_011538839.1. XM_011540537.2. [O95399-2]
XP_011538840.1. XM_011540538.1. [O95399-1]
UniGeneiHs.715862.

3D structure databases

ProteinModelPortaliO95399.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116116. 2 interactors.
IntActiO95399. 1 interactor.

Chemistry databases

BindingDBiO95399.
ChEMBLiCHEMBL6165.

Polymorphism and mutation databases

BioMutaiUTS2.

Proteomic databases

EPDiO95399.
MaxQBiO95399.
PeptideAtlasiO95399.
PRIDEiO95399.

Protocols and materials databases

DNASUi10911.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000054668; ENSP00000054668; ENSG00000049247. [O95399-2]
ENST00000361696; ENSP00000355163; ENSG00000049247. [O95399-1]
GeneIDi10911.
KEGGihsa:10911.
UCSCiuc001aor.4. human. [O95399-1]

Organism-specific databases

CTDi10911.
DisGeNETi10911.
GeneCardsiUTS2.
HGNCiHGNC:12636. UTS2.
HPAiHPA017000.
MIMi604097. gene.
neXtProtiNX_O95399.
OpenTargetsiENSG00000049247.
PharmGKBiPA37261.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00510000049583.
HOGENOMiHOG000136847.
HOVERGENiHBG065793.
InParanoidiO95399.
KOiK05248.
OMAiCPLFSLP.
OrthoDBiEOG091G12LI.
PhylomeDBiO95399.
TreeFamiTF330799.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000049247-MONOMER.
ReactomeiR-HSA-375276. Peptide ligand-binding receptors.
R-HSA-416476. G alpha (q) signalling events.

Miscellaneous databases

ChiTaRSiUTS2. human.
GeneWikiiUTS2.
GenomeRNAii10911.
PROiO95399.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000049247.
CleanExiHS_UTS2.
ExpressionAtlasiO95399. baseline and differential.
GenevisibleiO95399. HS.

Family and domain databases

InterProiIPR001483. Urotensin_II.
[Graphical view]
PfamiPF02083. Urotensin_II. 1 hit.
[Graphical view]
PROSITEiPS00984. UROTENSIN_II. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiUTS2_HUMAN
AccessioniPrimary (citable) accession number: O95399
Secondary accession number(s): Q5H8X7, Q6UXF6, Q9UKP7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 1999
Last modified: November 2, 2016
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.