Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95399

- UTS2_HUMAN

UniProt

O95399 - UTS2_HUMAN

Protein

Urotensin-2

Gene

UTS2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Highly potent vasoconstrictor.

    GO - Molecular functioni

    1. hormone activity Source: ProtInc
    2. receptor binding Source: ProtInc

    GO - Biological processi

    1. muscle contraction Source: ProtInc
    2. negative regulation of blood pressure Source: Ensembl
    3. negative regulation of glomerular filtration Source: Ensembl
    4. negative regulation of heart rate Source: Ensembl
    5. negative regulation of insulin secretion Source: Ensembl
    6. negative regulation of renal sodium excretion Source: Ensembl
    7. negative regulation of urine volume Source: Ensembl
    8. positive regulation of angiogenesis Source: Ensembl
    9. positive regulation of blood pressure Source: Ensembl
    10. positive regulation of cell differentiation Source: Ensembl
    11. positive regulation of circadian sleep/wake cycle, REM sleep Source: Ensembl
    12. positive regulation of circadian sleep/wake cycle, wakefulness Source: Ensembl
    13. positive regulation of collagen biosynthetic process Source: Ensembl
    14. positive regulation of cytosolic calcium ion concentration Source: Ensembl
    15. positive regulation of fibroblast migration Source: Ensembl
    16. positive regulation of fibroblast proliferation Source: Ensembl
    17. positive regulation of heart rate Source: Ensembl
    18. positive regulation of synaptic transmission, cholinergic Source: Ensembl
    19. positive regulation of vasodilation Source: Ensembl
    20. regulation of blood pressure Source: ProtInc
    21. response to drug Source: Ensembl
    22. response to hypoxia Source: Ensembl
    23. response to testosterone Source: Ensembl
    24. synaptic transmission Source: ProtInc

    Keywords - Molecular functioni

    Hormone

    Enzyme and pathway databases

    ReactomeiREACT_14819. Peptide ligand-binding receptors.
    REACT_18283. G alpha (q) signalling events.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Urotensin-2
    Alternative name(s):
    Urotensin II
    Short name:
    U-II
    Short name:
    UII
    Gene namesi
    Name:UTS2
    ORF Names:UNQ525/PRO1068
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:12636. UTS2.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: Reactome
    2. extracellular space Source: ProtInc

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37261.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2020Add
    BLAST
    Propeptidei21 – 11090PRO_0000036346Add
    BLAST
    Peptidei114 – 12411Urotensin-2PRO_0000036347Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi118 ↔ 123By similarity

    Keywords - PTMi

    Cleavage on pair of basic residues, Disulfide bond

    Proteomic databases

    MaxQBiO95399.
    PaxDbiO95399.
    PRIDEiO95399.

    PTM databases

    PhosphoSiteiO95399.

    Expressioni

    Tissue specificityi

    Brain specific.

    Gene expression databases

    ArrayExpressiO95399.
    BgeeiO95399.
    CleanExiHS_UTS2.
    GenevestigatoriO95399.

    Organism-specific databases

    HPAiHPA017000.

    Interactioni

    Protein-protein interaction databases

    BioGridi116116. 1 interaction.
    STRINGi9606.ENSP00000054668.

    Structurei

    3D structure databases

    ProteinModelPortaliO95399.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the urotensin-2 family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG298147.
    HOGENOMiHOG000136847.
    HOVERGENiHBG065793.
    KOiK05248.
    OMAiKDRKQYK.
    PhylomeDBiO95399.
    TreeFamiTF330799.

    Family and domain databases

    InterProiIPR001483. Urotensin_II.
    [Graphical view]
    PfamiPF02083. Urotensin_II. 1 hit.
    [Graphical view]
    PROSITEiPS00984. UROTENSIN_II. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O95399-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MYKLASCCLL FIGFLNPLLS LPLLDSREIS FQLSAPHEDA RLTPEELERA    50
    SLLQILPEML GAERGDILRK ADSSTNIFNP RGNLRKFQDF SGQDPNILLS 100
    HLLARIWKPY KKRETPDCFW KYCV 124
    Length:124
    Mass (Da):14,296
    Last modified:May 1, 1999 - v1
    Checksum:iC7A5FC7EFE00D312
    GO
    Isoform 2 (identifier: O95399-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-27: MYKLASCCLLFIGFLNPLLSLPLLDSR → METNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLL

    Note: No experimental confirmation available.

    Show »
    Length:139
    Mass (Da):16,029
    Checksum:i8E8FFEF916A105BD
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti12 – 121I → T.1 Publication
    Corresponds to variant rs34305100 [ dbSNP | Ensembl ].
    VAR_053734
    Natural varianti74 – 741S → N.
    Corresponds to variant rs2890565 [ dbSNP | Ensembl ].
    VAR_029313

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2727MYKLA…LLDSR → METNVFHLMLCVTSARTHKS TSLCFGHFNSYPSLPLIHDL LL in isoform 2. 1 PublicationVSP_013638Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF104118 mRNA. Translation: AAD13070.1.
    AF140630 mRNA. Translation: AAD55577.1.
    AY358375 mRNA. Translation: AAQ88741.1.
    Z98884 Genomic DNA. Translation: CAB63148.1.
    Z98884 Genomic DNA. Translation: CAI21438.1.
    CCDSiCCDS90.1. [O95399-2]
    CCDS91.1. [O95399-1]
    RefSeqiNP_006777.1. NM_006786.3. [O95399-1]
    NP_068835.1. NM_021995.2. [O95399-2]
    UniGeneiHs.715862.

    Genome annotation databases

    EnsembliENST00000054668; ENSP00000054668; ENSG00000049247. [O95399-2]
    ENST00000361696; ENSP00000355163; ENSG00000049247. [O95399-1]
    GeneIDi10911.
    KEGGihsa:10911.
    UCSCiuc001aor.3. human. [O95399-1]
    uc001aos.3. human. [O95399-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF104118 mRNA. Translation: AAD13070.1 .
    AF140630 mRNA. Translation: AAD55577.1 .
    AY358375 mRNA. Translation: AAQ88741.1 .
    Z98884 Genomic DNA. Translation: CAB63148.1 .
    Z98884 Genomic DNA. Translation: CAI21438.1 .
    CCDSi CCDS90.1. [O95399-2 ]
    CCDS91.1. [O95399-1 ]
    RefSeqi NP_006777.1. NM_006786.3. [O95399-1 ]
    NP_068835.1. NM_021995.2. [O95399-2 ]
    UniGenei Hs.715862.

    3D structure databases

    ProteinModelPortali O95399.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116116. 1 interaction.
    STRINGi 9606.ENSP00000054668.

    Chemistry

    BindingDBi O95399.
    ChEMBLi CHEMBL6165.

    PTM databases

    PhosphoSitei O95399.

    Proteomic databases

    MaxQBi O95399.
    PaxDbi O95399.
    PRIDEi O95399.

    Protocols and materials databases

    DNASUi 10911.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000054668 ; ENSP00000054668 ; ENSG00000049247 . [O95399-2 ]
    ENST00000361696 ; ENSP00000355163 ; ENSG00000049247 . [O95399-1 ]
    GeneIDi 10911.
    KEGGi hsa:10911.
    UCSCi uc001aor.3. human. [O95399-1 ]
    uc001aos.3. human. [O95399-2 ]

    Organism-specific databases

    CTDi 10911.
    GeneCardsi GC01M007904.
    HGNCi HGNC:12636. UTS2.
    HPAi HPA017000.
    MIMi 604097. gene.
    neXtProti NX_O95399.
    PharmGKBi PA37261.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG298147.
    HOGENOMi HOG000136847.
    HOVERGENi HBG065793.
    KOi K05248.
    OMAi KDRKQYK.
    PhylomeDBi O95399.
    TreeFami TF330799.

    Enzyme and pathway databases

    Reactomei REACT_14819. Peptide ligand-binding receptors.
    REACT_18283. G alpha (q) signalling events.

    Miscellaneous databases

    GeneWikii UTS2.
    GenomeRNAii 10911.
    NextBioi 41439.
    PROi O95399.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95399.
    Bgeei O95399.
    CleanExi HS_UTS2.
    Genevestigatori O95399.

    Family and domain databases

    InterProi IPR001483. Urotensin_II.
    [Graphical view ]
    Pfami PF02083. Urotensin_II. 1 hit.
    [Graphical view ]
    PROSITEi PS00984. UROTENSIN_II. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning of the cDNA encoding the urotensin II precursor in frog and human reveals intense expression of the urotensin II gene in motoneurons of the spinal cord."
      Coulouarn Y., Lihrmann I., Jegou S., Anouar Y., Tostivint H., Beauvillain J.-C., Conlon J.M., Bern H.A., Vaudry H.
      Proc. Natl. Acad. Sci. U.S.A. 95:15803-15808(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Spinal cord.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-12.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
      Zhang Z., Henzel W.J.
      Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 21-35 (ISOFORM 1).

    Entry informationi

    Entry nameiUTS2_HUMAN
    AccessioniPrimary (citable) accession number: O95399
    Secondary accession number(s): Q5H8X7, Q6UXF6, Q9UKP7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 114 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3