O95399 (UTS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Names and origin

Protein names

Recommended name:
Urotensin-2

Alternative name(s):
Urotensin II
Short name=U-II
Short name=UII

Gene names

Name:	UTS2
ORF Names:	UNQ525/PRO1068

Organism

Homo sapiens (Human) [Reference proteome]

Taxonomic identifier

9606 [NCBI]

Taxonomic lineage

cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo

Protein attributes

Sequence length	124 AA.
Sequence status	Complete.
Sequence processing	The displayed sequence is further processed into a mature form.
Protein existence	Evidence at protein level

General annotation (Comments)

Function	Highly potent vasoconstrictor.
Subcellular location	Secreted.
Tissue specificity	Brain specific.
Sequence similarities	Belongs to the urotensin-2 family.

Ontologies

Keywords
Cellular component	Secreted
Coding sequence diversity	Alternative splicing Polymorphism
Domain	Signal
Molecular function	Hormone
PTM	Cleavage on pair of basic residues Disulfide bond
Technical term	Complete proteome Direct protein sequencing Reference proteome
Gene Ontology (GO)
Biological_process	elevation of cytosolic calcium ion concentration Inferred from electronic annotation. Source: Compara muscle contraction Traceable author statement Ref.2. Source: ProtInc negative regulation of blood pressure Inferred from electronic annotation. Source: Compara negative regulation of glomerular filtration Inferred from electronic annotation. Source: Compara negative regulation of heart rate Inferred from electronic annotation. Source: Compara negative regulation of insulin secretion Inferred from electronic annotation. Source: Compara negative regulation of renal sodium excretion Inferred from electronic annotation. Source: Compara negative regulation of urine volume Inferred from electronic annotation. Source: Compara positive regulation of angiogenesis Inferred from electronic annotation. Source: Compara positive regulation of blood pressure Inferred from electronic annotation. Source: Compara positive regulation of cell differentiation Inferred from electronic annotation. Source: Compara positive regulation of circadian sleep/wake cycle, REM sleep Inferred from electronic annotation. Source: Compara positive regulation of circadian sleep/wake cycle, wakefulness Inferred from electronic annotation. Source: Compara positive regulation of collagen biosynthetic process Inferred from electronic annotation. Source: Compara positive regulation of fibroblast migration Inferred from electronic annotation. Source: Compara positive regulation of fibroblast proliferation Inferred from electronic annotation. Source: Compara positive regulation of heart rate Inferred from electronic annotation. Source: Compara positive regulation of synaptic transmission, cholinergic Inferred from electronic annotation. Source: Compara positive regulation of vasodilation Inferred from electronic annotation. Source: Compara regulation of blood pressure Traceable author statement Ref.2. Source: ProtInc response to drug Inferred from electronic annotation. Source: Compara response to hypoxia Inferred from electronic annotation. Source: Compara response to testosterone stimulus Inferred from electronic annotation. Source: Compara synaptic transmission Traceable author statement Ref.2. Source: ProtInc
Cellular_component	extracellular space Traceable author statement Ref.2. Source: ProtInc
Molecular_function	hormone activity Traceable author statement Ref.2. Source: ProtInc
Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]

Isoform 1 (identifier: O95399-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

Isoform 2 (identifier: O95399-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MYKLASCCLLFIGFLNPLLSLPLLDSR → METNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLL

Note: No experimental confirmation available.

Sequence annotation (Features)

	Feature key	Position(s)	Length	Description	Graphical view	Feature identifier
Molecule processing
	Signal peptide	1 – 20	20	Ref.5
	Propeptide	21 – 110	90			PRO_0000036346
	Peptide	114 – 124	11	Urotensin-2		PRO_0000036347
Amino acid modifications
	Disulfide bond	118 ↔ 123		By similarity
Natural variations
	Alternative sequence	1 – 27	27	MYKLA…LLDSR → METNVFHLMLCVTSARTHKS TSLCFGHFNSYPSLPLIHDL LL in isoform 2.		VSP_013638
	Natural variant	12	1	I → T. Ref.3 Corresponds to variant rs34305100 [ dbSNP | Ensembl ].		VAR_053734
	Natural variant	74	1	S → N. Corresponds to variant rs2890565 [ dbSNP | Ensembl ].		VAR_029313

Sequences

	Sequence		Length	Mass (Da)
	Isoform 1 [UniParc]. Last modified May 1, 1999. Version 1. Checksum: C7A5FC7EFE00D312	FASTA	124	14,296
	10 20 30 40 50 60 MYKLASCCLL FIGFLNPLLS LPLLDSREIS FQLSAPHEDA RLTPEELERA SLLQILPEML 70 80 90 100 110 120 GAERGDILRK ADSSTNIFNP RGNLRKFQDF SGQDPNILLS HLLARIWKPY KKRETPDCFW KYCV
	Isoform 2 [UniParc]. Checksum: 8E8FFEF916A105BD	FASTA	139	16,029
	10 20 30 40 50 60 METNVFHLML CVTSARTHKS TSLCFGHFNS YPSLPLIHDL LLEISFQLSA PHEDARLTPE 70 80 90 100 110 120 ELERASLLQI LPEMLGAERG DILRKADSST NIFNPRGNLR KFQDFSGQDP NILLSHLLAR 130 IWKPYKKRET PDCFWKYCV

References

	« Hide 'large scale' referencesShow 'large scale' references »
[1]	"Cloning of the cDNA encoding the urotensin II precursor in frog and human reveals intense expression of the urotensin II gene in motoneurons of the spinal cord." Coulouarn Y., Lihrmann I., Jegou S., Anouar Y., Tostivint H., Beauvillain J.-C., Conlon J.M., Bern H.A., Vaudry H. Proc. Natl. Acad. Sci. U.S.A. 95:15803-15808(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Spinal cord.
[2]	"Human urotensin-II is a potent vasoconstrictor and agonist for the orphan receptor GPR14." Ames R.S., Sarau H.M., Chambers J.K., Willette R.N., Aiyar N.V., Romanic A.M., Louden C.S., Foley J.J., Sauermelch C.F., Coatney R.W., Ao Z., Disa J., Holmes S.D., Stadel J.M., Martin J.D., Liu W.-S., Glover G.I., Wilson S. , McNulty D.E., Ellis C.E., Elshourbagy N.A., Shabon U., Trill J.J., Hay D.W.P., Ohlstein E.H., Bergsma D.J., Douglas S.A. Nature 401:282-286(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[3]	"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M. Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-12.
[4]	"The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R. Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]	"Signal peptide prediction based on analysis of experimentally verified cleavage sites." Zhang Z., Henzel W.J. Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 21-35 (ISOFORM 1).
[6]	"Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+	Additional computationally mapped references.

Cross-references

Sequence databases
EMBL GenBank DDBJ	AF104118 mRNA. Translation: AAD13070.1. AF140630 mRNA. Translation: AAD55577.1. AY358375 mRNA. Translation: AAQ88741.1. Z98884 Genomic DNA. Translation: CAB63148.1. Z98884 Genomic DNA. Translation: CAI21438.1.
IPI	IPI00030122. IPI00419728.
RefSeq	NP_006777.1. NM_006786.3. NP_068835.1. NM_021995.2.
UniGene	Hs.715862.
3D structure databases
ProteinModelPortal	O95399.
ModBase	Search...
Protein-protein interaction databases
STRING	9606.ENSP00000054668.
PTM databases
PhosphoSite	O95399.
Proteomic databases
PaxDb	O95399.
PRIDE	O95399.
Protocols and materials databases
DNASU	10911.
StructuralBiologyKnowledgebase	Search...
Genome annotation databases
Ensembl	ENST00000054668; ENSP00000054668; ENSG00000049247. ENST00000361696; ENSP00000355163; ENSG00000049247.
GeneID	10911.
KEGG	hsa:10911.
UCSC	uc001aor.3. human. uc001aos.3. human.
Organism-specific databases
CTD	10911.
GeneCards	GC01M007904.
HGNC	HGNC:12636. UTS2.
HPA	HPA017000.
MIM	604097. gene.
neXtProt	NX_O95399.
PharmGKB	PA37261.
GenAtlas	Search...
Phylogenomic databases
eggNOG	NOG298147.
HOGENOM	HOG000136847.
HOVERGEN	HBG065793.
KO	K05248.
OMA	GNLSECF.
Enzyme and pathway databases
Reactome	REACT_111102. Signal Transduction.
Gene expression databases
ArrayExpress	O95399.
Bgee	O95399.
CleanEx	HS_UTS2.
Genevestigator	O95399.
GermOnline	ENSG00000049247. Homo sapiens.
Family and domain databases
InterPro	IPR001483. Urotensin_II. [Graphical view]
Pfam	PF02083. Urotensin_II. 1 hit. [Graphical view]
PROSITE	PS00984. UROTENSIN_II. 1 hit. [Graphical view]
ProtoNet	Search...
Other
BindingDB	O95399.
ChEMBL	CHEMBL6165.
GenomeRNAi	10911.
NextBio	41439.
SOURCE	Search...

Entry information

Entry name

UTS2_HUMAN

Accession

Primary (citable) accession number: O95399
Secondary accession number(s): Q5H8X7, Q6UXF6, Q9UKP7

Entry history

Integrated into UniProtKB/Swiss-Prot:	December 1, 2000
Last sequence update:	May 1, 1999
Last modified:	April 3, 2013
This is version 103 of the entry and version 1 of the sequence. [Complete history]

Entry status

Reviewed (UniProtKB/Swiss-Prot)

Annotation program

Chordata Protein Annotation Program

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.