Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95388

- WISP1_HUMAN

UniProt

O95388 - WISP1_HUMAN

Protein

WNT1-inducible-signaling pathway protein 1

Gene

WISP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 125 (01 Oct 2014)
      Sequence version 1 (01 May 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Downstream regulator in the Wnt/Frizzled-signaling pathway. Associated with cell survival. Attenuates p53-mediated apoptosis in response to DNA damage through activation of AKT kinase. Up-regulates the anti-apoptotic Bcl-X(L) protein. Adheres to skin and melanoma fibroblasts. In vitro binding to skin fibroblasts occurs through the proteoglycans, decorin and biglycan.2 Publications

    GO - Biological processi

    1. cell adhesion Source: UniProtKB-KW
    2. cell-cell signaling Source: ProtInc
    3. regulation of cell growth Source: InterPro
    4. signal transduction Source: ProtInc
    5. Wnt signaling pathway Source: UniProtKB-KW

    Keywords - Biological processi

    Cell adhesion, Wnt signaling pathway

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    WNT1-inducible-signaling pathway protein 1
    Short name:
    WISP-1
    Alternative name(s):
    CCN family member 4
    Wnt-1-induced secreted protein
    Gene namesi
    Name:WISP1
    Synonyms:CCN4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:12769. WISP1.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. extracellular space Source: UniProtKB

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Keywords - Diseasei

    Proto-oncogene

    Organism-specific databases

    PharmGKBiPA37372.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2222Sequence AnalysisAdd
    BLAST
    Chaini23 – 367345WNT1-inducible-signaling pathway protein 1PRO_0000014406Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi86 – 861N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi143 – 1431N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi273 ↔ 310By similarity
    Glycosylationi284 – 2841N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi290 ↔ 324By similarity
    Disulfide bondi301 ↔ 340By similarity
    Disulfide bondi304 ↔ 342By similarity
    Disulfide bondi309 ↔ 346By similarity
    Glycosylationi343 – 3431N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiO95388.
    PRIDEiO95388.

    PTM databases

    PhosphoSiteiO95388.

    Expressioni

    Tissue specificityi

    Expressed in heart, kidney, lung, pancreas, placenta, ovary, small intestine and spleen. Isoform 2 is expressed predominantly in scirrhous gastric carcinoma and, weakly in placenta. Overexpression is associated with several cancers including breast cancer and colon tumors. Isoform 2 is overexpressed in scirrhous gastric carcinoma.

    Gene expression databases

    ArrayExpressiO95388.
    BgeeiO95388.
    CleanExiHS_WISP1.
    GenevestigatoriO95388.

    Organism-specific databases

    HPAiCAB012205.
    HPA007121.

    Interactioni

    Protein-protein interaction databases

    BioGridi114367. 1 interaction.
    STRINGi9606.ENSP00000250160.

    Structurei

    3D structure databases

    ProteinModelPortaliO95388.
    SMRiO95388. Positions 282-347.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini40 – 11879IGFBP N-terminalPROSITE-ProRule annotationAdd
    BLAST
    Domaini121 – 18666VWFCPROSITE-ProRule annotationAdd
    BLAST
    Domaini215 – 26046TSP type-1PROSITE-ProRule annotationAdd
    BLAST
    Domaini273 – 34775CTCKPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the CCN family.Curated
    Contains 1 CTCK (C-terminal cystine knot-like) domain.PROSITE-ProRule annotation
    Contains 1 IGFBP N-terminal domain.PROSITE-ProRule annotation
    Contains 1 TSP type-1 domain.PROSITE-ProRule annotation
    Contains 1 VWFC domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG76761.
    HOGENOMiHOG000231462.
    HOVERGENiHBG000635.
    InParanoidiO95388.
    OMAiVDITKHI.
    PhylomeDBiO95388.
    TreeFamiTF326070.

    Family and domain databases

    InterProiIPR006207. Cys_knot_C.
    IPR006208. Glyco_hormone_CN.
    IPR009030. Growth_fac_rcpt_N_dom.
    IPR000867. IGFBP-like.
    IPR012395. IGFBP_CNN.
    IPR017891. Insulin_GF-bd_Cys-rich_CS.
    IPR000884. Thrombospondin_1_rpt.
    IPR001007. VWF_C.
    [Graphical view]
    PfamiPF00007. Cys_knot. 1 hit.
    PF00219. IGFBP. 1 hit.
    PF00090. TSP_1. 1 hit.
    PF00093. VWC. 1 hit.
    [Graphical view]
    PIRSFiPIRSF036495. IGFBP_rP_CNN. 1 hit.
    SMARTiSM00041. CT. 1 hit.
    SM00121. IB. 1 hit.
    SM00209. TSP1. 1 hit.
    SM00214. VWC. 1 hit.
    [Graphical view]
    SUPFAMiSSF57184. SSF57184. 1 hit.
    SSF82895. SSF82895. 1 hit.
    PROSITEiPS01185. CTCK_1. 1 hit.
    PS01225. CTCK_2. 1 hit.
    PS00222. IGFBP_N_1. 1 hit.
    PS51323. IGFBP_N_2. 1 hit.
    PS50092. TSP1. 1 hit.
    PS01208. VWFC_1. 1 hit.
    PS50184. VWFC_2. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O95388-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRWFLPWTLA AVTAAAASTV LATALSPAPT TMDFTPAPLE DTSSRPQFCK    50
    WPCECPPSPP RCPLGVSLIT DGCECCKMCA QQLGDNCTEA AICDPHRGLY 100
    CDYSGDRPRY AIGVCAQVVG VGCVLDGVRY NNGQSFQPNC KYNCTCIDGA 150
    VGCTPLCLRV RPPRLWCPHP RRVSIPGHCC EQWVCEDDAK RPRKTAPRDT 200
    GAFDAVGEVE AWHRNCIAYT SPWSPCSTSC GLGVSTRISN VNAQCWPEQE 250
    SRLCNLRPCD VDIHTLIKAG KKCLAVYQPE ASMNFTLAGC ISTRSYQPKY 300
    CGVCMDNRCC IPYKSKTIDV SFQCPDGLGF SRQVLWINAC FCNLSCRNPN 350
    DIFADLESYP DFSEIAN 367
    Length:367
    Mass (Da):40,331
    Last modified:May 1, 1999 - v1
    Checksum:i9F29CA94D69C0502
    GO
    Isoform 2 (identifier: O95388-2) [UniParc]FASTAAdd to Basket

    Also known as: WISP1v

    The sequence of this isoform differs from the canonical sequence as follows:
         117-117: Q → H
         118-204: Missing.

    Show »
    Length:280
    Mass (Da):30,697
    Checksum:i26B254D4A060738E
    GO
    Isoform 3 (identifier: O95388-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         24-268: Missing.

    Show »
    Length:122
    Mass (Da):13,490
    Checksum:iBFFABA376CB30BE8
    GO
    Isoform 4 (identifier: O95388-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         117-155: QVVGVGCVLD...CIDGAVGCTP → RREEVSGCVP...TQVLWSLHGQ
         156-367: Missing.

    Show »
    Length:155
    Mass (Da):16,802
    Checksum:i68B64C21B83E7E40
    GO
    Isoform 5 (identifier: O95388-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-31: MRWFLPWTLAAVTAAAASTVLATALSPAPTT → MPVPLTSRHEVVPALDAGSSDSSSRQHRPGH
         32-203: Missing.

    Show »
    Length:195
    Mass (Da):21,550
    Checksum:i09116547C1D5E824
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti91 – 911A → V in AAP43926. 1 PublicationCurated
    Isoform 4 (identifier: O95388-4)
    Sequence conflicti155 – 1551Q → QQVLHPLQV in AAP43926. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti205 – 2051A → S.
    Corresponds to variant rs35513885 [ dbSNP | Ensembl ].
    VAR_061265

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3131MRWFL…PAPTT → MPVPLTSRHEVVPALDAGSS DSSSRQHRPGH in isoform 5. 2 PublicationsVSP_047706Add
    BLAST
    Alternative sequencei24 – 268245Missing in isoform 3. 1 PublicationVSP_042010Add
    BLAST
    Alternative sequencei32 – 203172Missing in isoform 5. 2 PublicationsVSP_047707Add
    BLAST
    Alternative sequencei117 – 15539QVVGV…VGCTP → RREEVSGCVPARGIHELHTC GLHQHTLLSTQVLWSLHGQ in isoform 4. 1 PublicationVSP_045958Add
    BLAST
    Alternative sequencei117 – 1171Q → H in isoform 2. 1 PublicationVSP_008008
    Alternative sequencei118 – 20487Missing in isoform 2. 1 PublicationVSP_008009Add
    BLAST
    Alternative sequencei156 – 367212Missing in isoform 4. 1 PublicationVSP_045959Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF100779 mRNA. Translation: AAC96321.1.
    AB034725 mRNA. Translation: BAB17849.1.
    AY196486 mRNA. Translation: AAP43924.1.
    AY196487 mRNA. Translation: AAP43925.1.
    AY196488 mRNA. Translation: AAP43926.1.
    AK293031 mRNA. Translation: BAF85720.1.
    AK301508 mRNA. Translation: BAG63017.1.
    AF192304 Genomic DNA. No translation available.
    CH471060 Genomic DNA. Translation: EAW92162.1.
    BC074840 mRNA. Translation: AAH74840.1.
    BC074841 mRNA. Translation: AAH74841.1.
    CCDSiCCDS56555.1. [O95388-4]
    CCDS56556.1. [O95388-3]
    CCDS6371.1. [O95388-1]
    CCDS6372.1. [O95388-2]
    RefSeqiNP_001191798.1. NM_001204869.1. [O95388-4]
    NP_001191799.1. NM_001204870.1. [O95388-3]
    NP_003873.1. NM_003882.3. [O95388-1]
    NP_543028.1. NM_080838.2. [O95388-2]
    UniGeneiHs.492974.

    Genome annotation databases

    EnsembliENST00000220856; ENSP00000220856; ENSG00000104415. [O95388-2]
    ENST00000250160; ENSP00000250160; ENSG00000104415. [O95388-1]
    ENST00000517423; ENSP00000427744; ENSG00000104415. [O95388-4]
    ENST00000519433; ENSP00000429185; ENSG00000104415. [O95388-3]
    GeneIDi8840.
    KEGGihsa:8840.
    UCSCiuc003yub.3. human. [O95388-1]
    uc003yuc.3. human. [O95388-2]
    uc010med.3. human. [O95388-3]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF100779 mRNA. Translation: AAC96321.1 .
    AB034725 mRNA. Translation: BAB17849.1 .
    AY196486 mRNA. Translation: AAP43924.1 .
    AY196487 mRNA. Translation: AAP43925.1 .
    AY196488 mRNA. Translation: AAP43926.1 .
    AK293031 mRNA. Translation: BAF85720.1 .
    AK301508 mRNA. Translation: BAG63017.1 .
    AF192304 Genomic DNA. No translation available.
    CH471060 Genomic DNA. Translation: EAW92162.1 .
    BC074840 mRNA. Translation: AAH74840.1 .
    BC074841 mRNA. Translation: AAH74841.1 .
    CCDSi CCDS56555.1. [O95388-4 ]
    CCDS56556.1. [O95388-3 ]
    CCDS6371.1. [O95388-1 ]
    CCDS6372.1. [O95388-2 ]
    RefSeqi NP_001191798.1. NM_001204869.1. [O95388-4 ]
    NP_001191799.1. NM_001204870.1. [O95388-3 ]
    NP_003873.1. NM_003882.3. [O95388-1 ]
    NP_543028.1. NM_080838.2. [O95388-2 ]
    UniGenei Hs.492974.

    3D structure databases

    ProteinModelPortali O95388.
    SMRi O95388. Positions 282-347.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114367. 1 interaction.
    STRINGi 9606.ENSP00000250160.

    PTM databases

    PhosphoSitei O95388.

    Proteomic databases

    PaxDbi O95388.
    PRIDEi O95388.

    Protocols and materials databases

    DNASUi 8840.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000220856 ; ENSP00000220856 ; ENSG00000104415 . [O95388-2 ]
    ENST00000250160 ; ENSP00000250160 ; ENSG00000104415 . [O95388-1 ]
    ENST00000517423 ; ENSP00000427744 ; ENSG00000104415 . [O95388-4 ]
    ENST00000519433 ; ENSP00000429185 ; ENSG00000104415 . [O95388-3 ]
    GeneIDi 8840.
    KEGGi hsa:8840.
    UCSCi uc003yub.3. human. [O95388-1 ]
    uc003yuc.3. human. [O95388-2 ]
    uc010med.3. human. [O95388-3 ]

    Organism-specific databases

    CTDi 8840.
    GeneCardsi GC08P134203.
    HGNCi HGNC:12769. WISP1.
    HPAi CAB012205.
    HPA007121.
    MIMi 603398. gene.
    neXtProti NX_O95388.
    PharmGKBi PA37372.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG76761.
    HOGENOMi HOG000231462.
    HOVERGENi HBG000635.
    InParanoidi O95388.
    OMAi VDITKHI.
    PhylomeDBi O95388.
    TreeFami TF326070.

    Miscellaneous databases

    GeneWikii WNT1-inducible-signaling_pathway_protein_1.
    GenomeRNAii 8840.
    NextBioi 33184.
    PROi O95388.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95388.
    Bgeei O95388.
    CleanExi HS_WISP1.
    Genevestigatori O95388.

    Family and domain databases

    InterProi IPR006207. Cys_knot_C.
    IPR006208. Glyco_hormone_CN.
    IPR009030. Growth_fac_rcpt_N_dom.
    IPR000867. IGFBP-like.
    IPR012395. IGFBP_CNN.
    IPR017891. Insulin_GF-bd_Cys-rich_CS.
    IPR000884. Thrombospondin_1_rpt.
    IPR001007. VWF_C.
    [Graphical view ]
    Pfami PF00007. Cys_knot. 1 hit.
    PF00219. IGFBP. 1 hit.
    PF00090. TSP_1. 1 hit.
    PF00093. VWC. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF036495. IGFBP_rP_CNN. 1 hit.
    SMARTi SM00041. CT. 1 hit.
    SM00121. IB. 1 hit.
    SM00209. TSP1. 1 hit.
    SM00214. VWC. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57184. SSF57184. 1 hit.
    SSF82895. SSF82895. 1 hit.
    PROSITEi PS01185. CTCK_1. 1 hit.
    PS01225. CTCK_2. 1 hit.
    PS00222. IGFBP_N_1. 1 hit.
    PS51323. IGFBP_N_2. 1 hit.
    PS50092. TSP1. 1 hit.
    PS01208. VWFC_1. 1 hit.
    PS50184. VWFC_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "WISP genes are members of the connective tissue growth factor family that are up-regulated in wnt-1-transformed cells and aberrantly expressed in human colon tumors."
      Pennica D., Swanson T.A., Welsh J.W., Roy M.A., Lawrence D.A., Lee J., Brush J., Taneyhill L.A., Deuel B., Lew M., Watanabe C., Cohen R.L., Melham M.F., Finley G.G., Quirke P., Goddard A.D., Hillan K.J., Gurney A.L., Botstein D., Levine A.J.
      Proc. Natl. Acad. Sci. U.S.A. 95:14717-14722(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Fetal kidney and Lung.
    2. "A novel variant of WISP1 lacking a Von Willebrand type C module overexpressed in scirrhous gastric carcinoma."
      Tanaka S., Sugimachi K., Saeki H., Kinoshita J., Ohga T., Shimada M., Maehara Y., Sugimachi K.
      Oncogene 20:5525-5532(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Gastric carcinoma.
    3. "Multiple alternatively spliced variants of WISP1 are overexpressed in pancreatic cancer."
      Li Z., Chiao P.J., Evans D.B.
      Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4 AND 5).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
      Tissue: Synovium and Uterus.
    5. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung.
    8. "WISP-1 is a Wnt-1- and beta-catenin-responsive oncogene."
      Xu L., Corcoran R.B., Welsh J.W., Pennica D., Levine A.J.
      Genes Dev. 14:585-595(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN WNT1 SIGNALING.
    9. "WISP-1 attenuates p53-mediated apoptosis in response to DNA damage through activation of the Akt kinase."
      Su F., Overholtzer M., Besser D., Levine A.J.
      Genes Dev. 16:46-57(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN TP53-MEDIATED APOPTOSIS.
    10. Cited for: INTERACTION WITH DECORIN AND BIGLYCAN.

    Entry informationi

    Entry nameiWISP1_HUMAN
    AccessioniPrimary (citable) accession number: O95388
    Secondary accession number(s): A8KAG6
    , E7EMM5, Q5JBS6, Q5JBS7, Q5JBS8, Q9HCS3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 15, 2003
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 125 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3