Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O95388

- WISP1_HUMAN

UniProt

O95388 - WISP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

WNT1-inducible-signaling pathway protein 1

Gene

WISP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Downstream regulator in the Wnt/Frizzled-signaling pathway. Associated with cell survival. Attenuates p53-mediated apoptosis in response to DNA damage through activation of AKT kinase. Up-regulates the anti-apoptotic Bcl-X(L) protein. Adheres to skin and melanoma fibroblasts. In vitro binding to skin fibroblasts occurs through the proteoglycans, decorin and biglycan.2 Publications

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
  2. cell-cell signaling Source: ProtInc
  3. regulation of cell growth Source: InterPro
  4. signal transduction Source: ProtInc
  5. Wnt signaling pathway Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Cell adhesion, Wnt signaling pathway

Names & Taxonomyi

Protein namesi
Recommended name:
WNT1-inducible-signaling pathway protein 1
Short name:
WISP-1
Alternative name(s):
CCN family member 4
Wnt-1-induced secreted protein
Gene namesi
Name:WISP1
Synonyms:CCN4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:12769. WISP1.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. extracellular space Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

PharmGKBiPA37372.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222Sequence AnalysisAdd
BLAST
Chaini23 – 367345WNT1-inducible-signaling pathway protein 1PRO_0000014406Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi86 – 861N-linked (GlcNAc...)Sequence Analysis
Glycosylationi143 – 1431N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi273 ↔ 310By similarity
Glycosylationi284 – 2841N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi290 ↔ 324By similarity
Disulfide bondi301 ↔ 340By similarity
Disulfide bondi304 ↔ 342By similarity
Disulfide bondi309 ↔ 346By similarity
Glycosylationi343 – 3431N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO95388.
PRIDEiO95388.

PTM databases

PhosphoSiteiO95388.

Expressioni

Tissue specificityi

Expressed in heart, kidney, lung, pancreas, placenta, ovary, small intestine and spleen. Isoform 2 is expressed predominantly in scirrhous gastric carcinoma and, weakly in placenta. Overexpression is associated with several cancers including breast cancer and colon tumors. Isoform 2 is overexpressed in scirrhous gastric carcinoma.

Gene expression databases

BgeeiO95388.
CleanExiHS_WISP1.
ExpressionAtlasiO95388. baseline and differential.
GenevestigatoriO95388.

Organism-specific databases

HPAiCAB012205.
HPA007121.

Interactioni

Protein-protein interaction databases

BioGridi114367. 1 interaction.
STRINGi9606.ENSP00000250160.

Structurei

3D structure databases

ProteinModelPortaliO95388.
SMRiO95388. Positions 59-156.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini40 – 11879IGFBP N-terminalPROSITE-ProRule annotationAdd
BLAST
Domaini121 – 18666VWFCPROSITE-ProRule annotationAdd
BLAST
Domaini215 – 26046TSP type-1PROSITE-ProRule annotationAdd
BLAST
Domaini273 – 34775CTCKPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the CCN family.Curated
Contains 1 CTCK (C-terminal cystine knot-like) domain.PROSITE-ProRule annotation
Contains 1 IGFBP N-terminal domain.PROSITE-ProRule annotation
Contains 1 TSP type-1 domain.PROSITE-ProRule annotation
Contains 1 VWFC domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG76761.
GeneTreeiENSGT00760000119225.
HOGENOMiHOG000231462.
HOVERGENiHBG000635.
InParanoidiO95388.
OMAiVDITKHI.
PhylomeDBiO95388.
TreeFamiTF326070.

Family and domain databases

InterProiIPR006207. Cys_knot_C.
IPR006208. Glyco_hormone_CN.
IPR009030. Growth_fac_rcpt_N_dom.
IPR000867. IGFBP-like.
IPR012395. IGFBP_CNN.
IPR017891. Insulin_GF-bd_Cys-rich_CS.
IPR000884. Thrombospondin_1_rpt.
IPR001007. VWF_C.
[Graphical view]
PfamiPF00007. Cys_knot. 1 hit.
PF00219. IGFBP. 1 hit.
PF00090. TSP_1. 1 hit.
PF00093. VWC. 1 hit.
[Graphical view]
PIRSFiPIRSF036495. IGFBP_rP_CNN. 1 hit.
SMARTiSM00041. CT. 1 hit.
SM00121. IB. 1 hit.
SM00209. TSP1. 1 hit.
SM00214. VWC. 1 hit.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 1 hit.
SSF82895. SSF82895. 1 hit.
PROSITEiPS01185. CTCK_1. 1 hit.
PS01225. CTCK_2. 1 hit.
PS00222. IGFBP_N_1. 1 hit.
PS51323. IGFBP_N_2. 1 hit.
PS50092. TSP1. 1 hit.
PS01208. VWFC_1. 1 hit.
PS50184. VWFC_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O95388-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRWFLPWTLA AVTAAAASTV LATALSPAPT TMDFTPAPLE DTSSRPQFCK
60 70 80 90 100
WPCECPPSPP RCPLGVSLIT DGCECCKMCA QQLGDNCTEA AICDPHRGLY
110 120 130 140 150
CDYSGDRPRY AIGVCAQVVG VGCVLDGVRY NNGQSFQPNC KYNCTCIDGA
160 170 180 190 200
VGCTPLCLRV RPPRLWCPHP RRVSIPGHCC EQWVCEDDAK RPRKTAPRDT
210 220 230 240 250
GAFDAVGEVE AWHRNCIAYT SPWSPCSTSC GLGVSTRISN VNAQCWPEQE
260 270 280 290 300
SRLCNLRPCD VDIHTLIKAG KKCLAVYQPE ASMNFTLAGC ISTRSYQPKY
310 320 330 340 350
CGVCMDNRCC IPYKSKTIDV SFQCPDGLGF SRQVLWINAC FCNLSCRNPN
360
DIFADLESYP DFSEIAN
Length:367
Mass (Da):40,331
Last modified:May 1, 1999 - v1
Checksum:i9F29CA94D69C0502
GO
Isoform 2 (identifier: O95388-2) [UniParc]FASTAAdd to Basket

Also known as: WISP1v

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: Q → H
     118-204: Missing.

Show »
Length:280
Mass (Da):30,697
Checksum:i26B254D4A060738E
GO
Isoform 3 (identifier: O95388-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-268: Missing.

Show »
Length:122
Mass (Da):13,490
Checksum:iBFFABA376CB30BE8
GO
Isoform 4 (identifier: O95388-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-155: QVVGVGCVLD...CIDGAVGCTP → RREEVSGCVP...TQVLWSLHGQ
     156-367: Missing.

Show »
Length:155
Mass (Da):16,802
Checksum:i68B64C21B83E7E40
GO
Isoform 5 (identifier: O95388-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MRWFLPWTLAAVTAAAASTVLATALSPAPTT → MPVPLTSRHEVVPALDAGSSDSSSRQHRPGH
     32-203: Missing.

Show »
Length:195
Mass (Da):21,550
Checksum:i09116547C1D5E824
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti91 – 911A → V in AAP43926. 1 PublicationCurated
Isoform 4 (identifier: O95388-4)
Sequence conflicti155 – 1551Q → QQVLHPLQV in AAP43926. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti205 – 2051A → S.
Corresponds to variant rs35513885 [ dbSNP | Ensembl ].
VAR_061265

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3131MRWFL…PAPTT → MPVPLTSRHEVVPALDAGSS DSSSRQHRPGH in isoform 5. 2 PublicationsVSP_047706Add
BLAST
Alternative sequencei24 – 268245Missing in isoform 3. 1 PublicationVSP_042010Add
BLAST
Alternative sequencei32 – 203172Missing in isoform 5. 2 PublicationsVSP_047707Add
BLAST
Alternative sequencei117 – 15539QVVGV…VGCTP → RREEVSGCVPARGIHELHTC GLHQHTLLSTQVLWSLHGQ in isoform 4. 1 PublicationVSP_045958Add
BLAST
Alternative sequencei117 – 1171Q → H in isoform 2. 1 PublicationVSP_008008
Alternative sequencei118 – 20487Missing in isoform 2. 1 PublicationVSP_008009Add
BLAST
Alternative sequencei156 – 367212Missing in isoform 4. 1 PublicationVSP_045959Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF100779 mRNA. Translation: AAC96321.1.
AB034725 mRNA. Translation: BAB17849.1.
AY196486 mRNA. Translation: AAP43924.1.
AY196487 mRNA. Translation: AAP43925.1.
AY196488 mRNA. Translation: AAP43926.1.
AK293031 mRNA. Translation: BAF85720.1.
AK301508 mRNA. Translation: BAG63017.1.
AF192304 Genomic DNA. No translation available.
CH471060 Genomic DNA. Translation: EAW92162.1.
BC074840 mRNA. Translation: AAH74840.1.
BC074841 mRNA. Translation: AAH74841.1.
CCDSiCCDS56555.1. [O95388-4]
CCDS56556.1. [O95388-3]
CCDS6371.1. [O95388-1]
CCDS6372.1. [O95388-2]
RefSeqiNP_001191798.1. NM_001204869.1. [O95388-4]
NP_001191799.1. NM_001204870.1. [O95388-3]
NP_003873.1. NM_003882.3. [O95388-1]
NP_543028.1. NM_080838.2. [O95388-2]
UniGeneiHs.492974.

Genome annotation databases

EnsembliENST00000220856; ENSP00000220856; ENSG00000104415. [O95388-2]
ENST00000250160; ENSP00000250160; ENSG00000104415. [O95388-1]
ENST00000517423; ENSP00000427744; ENSG00000104415. [O95388-4]
ENST00000519433; ENSP00000429185; ENSG00000104415. [O95388-3]
GeneIDi8840.
KEGGihsa:8840.
UCSCiuc003yub.3. human. [O95388-1]
uc003yuc.3. human. [O95388-2]
uc010med.3. human. [O95388-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF100779 mRNA. Translation: AAC96321.1 .
AB034725 mRNA. Translation: BAB17849.1 .
AY196486 mRNA. Translation: AAP43924.1 .
AY196487 mRNA. Translation: AAP43925.1 .
AY196488 mRNA. Translation: AAP43926.1 .
AK293031 mRNA. Translation: BAF85720.1 .
AK301508 mRNA. Translation: BAG63017.1 .
AF192304 Genomic DNA. No translation available.
CH471060 Genomic DNA. Translation: EAW92162.1 .
BC074840 mRNA. Translation: AAH74840.1 .
BC074841 mRNA. Translation: AAH74841.1 .
CCDSi CCDS56555.1. [O95388-4 ]
CCDS56556.1. [O95388-3 ]
CCDS6371.1. [O95388-1 ]
CCDS6372.1. [O95388-2 ]
RefSeqi NP_001191798.1. NM_001204869.1. [O95388-4 ]
NP_001191799.1. NM_001204870.1. [O95388-3 ]
NP_003873.1. NM_003882.3. [O95388-1 ]
NP_543028.1. NM_080838.2. [O95388-2 ]
UniGenei Hs.492974.

3D structure databases

ProteinModelPortali O95388.
SMRi O95388. Positions 59-156.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114367. 1 interaction.
STRINGi 9606.ENSP00000250160.

PTM databases

PhosphoSitei O95388.

Proteomic databases

PaxDbi O95388.
PRIDEi O95388.

Protocols and materials databases

DNASUi 8840.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000220856 ; ENSP00000220856 ; ENSG00000104415 . [O95388-2 ]
ENST00000250160 ; ENSP00000250160 ; ENSG00000104415 . [O95388-1 ]
ENST00000517423 ; ENSP00000427744 ; ENSG00000104415 . [O95388-4 ]
ENST00000519433 ; ENSP00000429185 ; ENSG00000104415 . [O95388-3 ]
GeneIDi 8840.
KEGGi hsa:8840.
UCSCi uc003yub.3. human. [O95388-1 ]
uc003yuc.3. human. [O95388-2 ]
uc010med.3. human. [O95388-3 ]

Organism-specific databases

CTDi 8840.
GeneCardsi GC08P134203.
HGNCi HGNC:12769. WISP1.
HPAi CAB012205.
HPA007121.
MIMi 603398. gene.
neXtProti NX_O95388.
PharmGKBi PA37372.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG76761.
GeneTreei ENSGT00760000119225.
HOGENOMi HOG000231462.
HOVERGENi HBG000635.
InParanoidi O95388.
OMAi VDITKHI.
PhylomeDBi O95388.
TreeFami TF326070.

Miscellaneous databases

ChiTaRSi WISP1. human.
GeneWikii WNT1-inducible-signaling_pathway_protein_1.
GenomeRNAii 8840.
NextBioi 33184.
PROi O95388.
SOURCEi Search...

Gene expression databases

Bgeei O95388.
CleanExi HS_WISP1.
ExpressionAtlasi O95388. baseline and differential.
Genevestigatori O95388.

Family and domain databases

InterProi IPR006207. Cys_knot_C.
IPR006208. Glyco_hormone_CN.
IPR009030. Growth_fac_rcpt_N_dom.
IPR000867. IGFBP-like.
IPR012395. IGFBP_CNN.
IPR017891. Insulin_GF-bd_Cys-rich_CS.
IPR000884. Thrombospondin_1_rpt.
IPR001007. VWF_C.
[Graphical view ]
Pfami PF00007. Cys_knot. 1 hit.
PF00219. IGFBP. 1 hit.
PF00090. TSP_1. 1 hit.
PF00093. VWC. 1 hit.
[Graphical view ]
PIRSFi PIRSF036495. IGFBP_rP_CNN. 1 hit.
SMARTi SM00041. CT. 1 hit.
SM00121. IB. 1 hit.
SM00209. TSP1. 1 hit.
SM00214. VWC. 1 hit.
[Graphical view ]
SUPFAMi SSF57184. SSF57184. 1 hit.
SSF82895. SSF82895. 1 hit.
PROSITEi PS01185. CTCK_1. 1 hit.
PS01225. CTCK_2. 1 hit.
PS00222. IGFBP_N_1. 1 hit.
PS51323. IGFBP_N_2. 1 hit.
PS50092. TSP1. 1 hit.
PS01208. VWFC_1. 1 hit.
PS50184. VWFC_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "WISP genes are members of the connective tissue growth factor family that are up-regulated in wnt-1-transformed cells and aberrantly expressed in human colon tumors."
    Pennica D., Swanson T.A., Welsh J.W., Roy M.A., Lawrence D.A., Lee J., Brush J., Taneyhill L.A., Deuel B., Lew M., Watanabe C., Cohen R.L., Melham M.F., Finley G.G., Quirke P., Goddard A.D., Hillan K.J., Gurney A.L., Botstein D., Levine A.J.
    Proc. Natl. Acad. Sci. U.S.A. 95:14717-14722(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Fetal kidney and Lung.
  2. "A novel variant of WISP1 lacking a Von Willebrand type C module overexpressed in scirrhous gastric carcinoma."
    Tanaka S., Sugimachi K., Saeki H., Kinoshita J., Ohga T., Shimada M., Maehara Y., Sugimachi K.
    Oncogene 20:5525-5532(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Gastric carcinoma.
  3. "Multiple alternatively spliced variants of WISP1 are overexpressed in pancreatic cancer."
    Li Z., Chiao P.J., Evans D.B.
    Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4 AND 5).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
    Tissue: Synovium and Uterus.
  5. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  8. "WISP-1 is a Wnt-1- and beta-catenin-responsive oncogene."
    Xu L., Corcoran R.B., Welsh J.W., Pennica D., Levine A.J.
    Genes Dev. 14:585-595(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN WNT1 SIGNALING.
  9. "WISP-1 attenuates p53-mediated apoptosis in response to DNA damage through activation of the Akt kinase."
    Su F., Overholtzer M., Besser D., Levine A.J.
    Genes Dev. 16:46-57(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN TP53-MEDIATED APOPTOSIS.
  10. Cited for: INTERACTION WITH DECORIN AND BIGLYCAN.

Entry informationi

Entry nameiWISP1_HUMAN
AccessioniPrimary (citable) accession number: O95388
Secondary accession number(s): A8KAG6
, E7EMM5, Q5JBS6, Q5JBS7, Q5JBS8, Q9HCS3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: May 1, 1999
Last modified: November 26, 2014
This is version 127 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3