Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O95388 (WISP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 121. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
WNT1-inducible-signaling pathway protein 1

Short name=WISP-1
Alternative name(s):
CCN family member 4
Wnt-1-induced secreted protein
Gene names
Name:WISP1
Synonyms:CCN4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length367 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Downstream regulator in the Wnt/Frizzled-signaling pathway. Associated with cell survival. Attenuates p53-mediated apoptosis in response to DNA damage through activation of AKT kinase. Up-regulates the anti-apoptotic Bcl-X(L) protein. Adheres to skin and melanoma fibroblasts. In vitro binding to skin fibroblasts occurs through the proteoglycans, decorin and biglycan. Ref.8 Ref.9

Subcellular location

Secreted.

Tissue specificity

Expressed in heart, kidney, lung, pancreas, placenta, ovary, small intestine and spleen. Isoform 2 is expressed predominantly in scirrhous gastric carcinoma and, weakly in placenta. Overexpression is associated with several cancers including breast cancer and colon tumors. Isoform 2 is overexpressed in scirrhous gastric carcinoma.

Sequence similarities

Belongs to the CCN family.

Contains 1 CTCK (C-terminal cystine knot-like) domain.

Contains 1 IGFBP N-terminal domain.

Contains 1 TSP type-1 domain.

Contains 1 VWFC domain.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O95388-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O95388-2)

Also known as: WISP1v;

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: Q → H
     118-204: Missing.
Isoform 3 (identifier: O95388-3)

The sequence of this isoform differs from the canonical sequence as follows:
     24-268: Missing.
Isoform 4 (identifier: O95388-4)

The sequence of this isoform differs from the canonical sequence as follows:
     117-155: QVVGVGCVLD...CIDGAVGCTP → RREEVSGCVP...TQVLWSLHGQ
     156-367: Missing.
Isoform 5 (identifier: O95388-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MRWFLPWTLAAVTAAAASTVLATALSPAPTT → MPVPLTSRHEVVPALDAGSSDSSSRQHRPGH
     32-203: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2222 Potential
Chain23 – 367345WNT1-inducible-signaling pathway protein 1
PRO_0000014406

Regions

Domain40 – 11879IGFBP N-terminal
Domain121 – 18666VWFC
Domain215 – 26046TSP type-1
Domain273 – 34775CTCK

Amino acid modifications

Glycosylation861N-linked (GlcNAc...) Potential
Glycosylation1431N-linked (GlcNAc...) Potential
Glycosylation2841N-linked (GlcNAc...) Potential
Glycosylation3431N-linked (GlcNAc...) Potential
Disulfide bond273 ↔ 310 By similarity
Disulfide bond290 ↔ 324 By similarity
Disulfide bond301 ↔ 340 By similarity
Disulfide bond304 ↔ 342 By similarity
Disulfide bond309 ↔ 346 By similarity

Natural variations

Alternative sequence1 – 3131MRWFL…PAPTT → MPVPLTSRHEVVPALDAGSS DSSSRQHRPGH in isoform 5.
VSP_047706
Alternative sequence24 – 268245Missing in isoform 3.
VSP_042010
Alternative sequence32 – 203172Missing in isoform 5.
VSP_047707
Alternative sequence117 – 15539QVVGV…VGCTP → RREEVSGCVPARGIHELHTC GLHQHTLLSTQVLWSLHGQ in isoform 4.
VSP_045958
Alternative sequence1171Q → H in isoform 2.
VSP_008008
Alternative sequence118 – 20487Missing in isoform 2.
VSP_008009
Alternative sequence156 – 367212Missing in isoform 4.
VSP_045959
Natural variant2051A → S.
Corresponds to variant rs35513885 [ dbSNP | Ensembl ].
VAR_061265

Experimental info

Sequence conflict911A → V in AAP43926. Ref.3
Isoform 4:
Sequence conflict1551Q → QQVLHPLQV in AAP43926. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 1999. Version 1.
Checksum: 9F29CA94D69C0502

FASTA36740,331
        10         20         30         40         50         60 
MRWFLPWTLA AVTAAAASTV LATALSPAPT TMDFTPAPLE DTSSRPQFCK WPCECPPSPP 

        70         80         90        100        110        120 
RCPLGVSLIT DGCECCKMCA QQLGDNCTEA AICDPHRGLY CDYSGDRPRY AIGVCAQVVG 

       130        140        150        160        170        180 
VGCVLDGVRY NNGQSFQPNC KYNCTCIDGA VGCTPLCLRV RPPRLWCPHP RRVSIPGHCC 

       190        200        210        220        230        240 
EQWVCEDDAK RPRKTAPRDT GAFDAVGEVE AWHRNCIAYT SPWSPCSTSC GLGVSTRISN 

       250        260        270        280        290        300 
VNAQCWPEQE SRLCNLRPCD VDIHTLIKAG KKCLAVYQPE ASMNFTLAGC ISTRSYQPKY 

       310        320        330        340        350        360 
CGVCMDNRCC IPYKSKTIDV SFQCPDGLGF SRQVLWINAC FCNLSCRNPN DIFADLESYP 


DFSEIAN 

« Hide

Isoform 2 (WISP1v) [UniParc].

Checksum: 26B254D4A060738E
Show »

FASTA28030,697
Isoform 3 [UniParc].

Checksum: BFFABA376CB30BE8
Show »

FASTA12213,490
Isoform 4 [UniParc].

Checksum: 68B64C21B83E7E40
Show »

FASTA15516,802
Isoform 5 [UniParc].

Checksum: 09116547C1D5E824
Show »

FASTA19521,550

References

« Hide 'large scale' references
[1]"WISP genes are members of the connective tissue growth factor family that are up-regulated in wnt-1-transformed cells and aberrantly expressed in human colon tumors."
Pennica D., Swanson T.A., Welsh J.W., Roy M.A., Lawrence D.A., Lee J., Brush J., Taneyhill L.A., Deuel B., Lew M., Watanabe C., Cohen R.L., Melham M.F., Finley G.G., Quirke P., Goddard A.D., Hillan K.J., Gurney A.L., Botstein D., Levine A.J.
Proc. Natl. Acad. Sci. U.S.A. 95:14717-14722(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Fetal kidney and Lung.
[2]"A novel variant of WISP1 lacking a Von Willebrand type C module overexpressed in scirrhous gastric carcinoma."
Tanaka S., Sugimachi K., Saeki H., Kinoshita J., Ohga T., Shimada M., Maehara Y., Sugimachi K.
Oncogene 20:5525-5532(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: Gastric carcinoma.
[3]"Multiple alternatively spliced variants of WISP1 are overexpressed in pancreatic cancer."
Li Z., Chiao P.J., Evans D.B.
Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4 AND 5).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
Tissue: Synovium and Uterus.
[5]"DNA sequence and analysis of human chromosome 8."
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. expand/collapse author list , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Lung.
[8]"WISP-1 is a Wnt-1- and beta-catenin-responsive oncogene."
Xu L., Corcoran R.B., Welsh J.W., Pennica D., Levine A.J.
Genes Dev. 14:585-595(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION IN WNT1 SIGNALING.
[9]"WISP-1 attenuates p53-mediated apoptosis in response to DNA damage through activation of the Akt kinase."
Su F., Overholtzer M., Besser D., Levine A.J.
Genes Dev. 16:46-57(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION IN TP53-MEDIATED APOPTOSIS.
[10]"WISP-1 binds to decorin and biglycan."
Desnoyers L., Arnott D., Pennica D.
J. Biol. Chem. 276:47599-47607(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH DECORIN AND BIGLYCAN.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF100779 mRNA. Translation: AAC96321.1.
AB034725 mRNA. Translation: BAB17849.1.
AY196486 mRNA. Translation: AAP43924.1.
AY196487 mRNA. Translation: AAP43925.1.
AY196488 mRNA. Translation: AAP43926.1.
AK293031 mRNA. Translation: BAF85720.1.
AK301508 mRNA. Translation: BAG63017.1.
AF192304 Genomic DNA. No translation available.
CH471060 Genomic DNA. Translation: EAW92162.1.
BC074840 mRNA. Translation: AAH74840.1.
BC074841 mRNA. Translation: AAH74841.1.
RefSeqNP_001191798.1. NM_001204869.1.
NP_001191799.1. NM_001204870.1.
NP_003873.1. NM_003882.3.
NP_543028.1. NM_080838.2.
UniGeneHs.492974.

3D structure databases

ProteinModelPortalO95388.
SMRO95388. Positions 48-137, 219-262, 281-344.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114367. 1 interaction.
STRING9606.ENSP00000250160.

PTM databases

PhosphoSiteO95388.

Proteomic databases

PaxDbO95388.
PRIDEO95388.

Protocols and materials databases

DNASU8840.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000220856; ENSP00000220856; ENSG00000104415. [O95388-2]
ENST00000250160; ENSP00000250160; ENSG00000104415. [O95388-1]
ENST00000377863; ENSP00000367094; ENSG00000104415. [O95388-5]
ENST00000517423; ENSP00000427744; ENSG00000104415. [O95388-4]
ENST00000519433; ENSP00000429185; ENSG00000104415. [O95388-3]
GeneID8840.
KEGGhsa:8840.
UCSCuc003yub.3. human. [O95388-1]
uc003yuc.3. human. [O95388-2]
uc010med.3. human. [O95388-3]

Organism-specific databases

CTD8840.
GeneCardsGC08P134203.
HGNCHGNC:12769. WISP1.
HPACAB012205.
HPA007121.
MIM603398. gene.
neXtProtNX_O95388.
PharmGKBPA37372.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG76761.
HOGENOMHOG000231462.
HOVERGENHBG000635.
InParanoidO95388.
OMAVDITKHI.
PhylomeDBO95388.
TreeFamTF326070.

Gene expression databases

ArrayExpressO95388.
BgeeO95388.
CleanExHS_WISP1.
GenevestigatorO95388.

Family and domain databases

InterProIPR006207. Cys_knot_C.
IPR006208. Glyco_hormone_CN.
IPR009030. Growth_fac_rcpt_N_dom.
IPR000867. IGFBP-like.
IPR012395. IGFBP_CNN.
IPR017891. Insulin_GF-bd_Cys-rich_CS.
IPR000884. Thrombospondin_1_rpt.
IPR001007. VWF_C.
[Graphical view]
PfamPF00007. Cys_knot. 1 hit.
PF00219. IGFBP. 1 hit.
PF00090. TSP_1. 1 hit.
PF00093. VWC. 1 hit.
[Graphical view]
PIRSFPIRSF036495. IGFBP_rP_CNN. 1 hit.
SMARTSM00041. CT. 1 hit.
SM00121. IB. 1 hit.
SM00209. TSP1. 1 hit.
SM00214. VWC. 1 hit.
[Graphical view]
SUPFAMSSF57184. SSF57184. 1 hit.
SSF82895. SSF82895. 1 hit.
PROSITEPS01185. CTCK_1. 1 hit.
PS01225. CTCK_2. 1 hit.
PS00222. IGFBP_N_1. 1 hit.
PS51323. IGFBP_N_2. 1 hit.
PS50092. TSP1. 1 hit.
PS01208. VWFC_1. 1 hit.
PS50184. VWFC_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiWNT1-inducible-signaling_pathway_protein_1.
GenomeRNAi8840.
NextBio33184.
PROO95388.
SOURCESearch...

Entry information

Entry nameWISP1_HUMAN
AccessionPrimary (citable) accession number: O95388
Secondary accession number(s): A8KAG6 expand/collapse secondary AC list , E7EMM5, Q5JBS6, Q5JBS7, Q5JBS8, Q9HCS3
Entry history
Integrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: May 1, 1999
Last modified: April 16, 2014
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM