Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WNT1-inducible-signaling pathway protein 1

Gene

WISP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Downstream regulator in the Wnt/Frizzled-signaling pathway. Associated with cell survival. Attenuates p53-mediated apoptosis in response to DNA damage through activation of AKT kinase. Up-regulates the anti-apoptotic Bcl-X(L) protein. Adheres to skin and melanoma fibroblasts. In vitro binding to skin fibroblasts occurs through the proteoglycans, decorin and biglycan.2 Publications

GO - Molecular functioni

GO - Biological processi

  • cell adhesion Source: GO_Central
  • cell-cell signaling Source: ProtInc
  • negative regulation of cell death Source: GO_Central
  • regulation of cell growth Source: InterPro
  • signal transduction Source: ProtInc
  • Wnt signaling pathway Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Cell adhesion, Wnt signaling pathway

Names & Taxonomyi

Protein namesi
Recommended name:
WNT1-inducible-signaling pathway protein 1
Short name:
WISP-1
Alternative name(s):
CCN family member 4
Wnt-1-induced secreted protein
Gene namesi
Name:WISP1
Synonyms:CCN4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:12769. WISP1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • extracellular space Source: UniProtKB
  • proteinaceous extracellular matrix Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNETi8840.
OpenTargetsiENSG00000104415.
PharmGKBiPA37372.

Polymorphism and mutation databases

BioMutaiWISP1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000001440623 – 367WNT1-inducible-signaling pathway protein 1Add BLAST345

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi86N-linked (GlcNAc...)Sequence analysis1
Glycosylationi143N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi273 ↔ 310By similarity
Glycosylationi284N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi290 ↔ 324By similarity
Disulfide bondi301 ↔ 340By similarity
Disulfide bondi304 ↔ 342By similarity
Disulfide bondi309 ↔ 346By similarity
Glycosylationi343N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO95388.
PeptideAtlasiO95388.
PRIDEiO95388.

PTM databases

iPTMnetiO95388.
PhosphoSitePlusiO95388.

Expressioni

Tissue specificityi

Expressed in heart, kidney, lung, pancreas, placenta, ovary, small intestine and spleen. Isoform 2 is expressed predominantly in scirrhous gastric carcinoma and, weakly in placenta. Overexpression is associated with several cancers including breast cancer and colon tumors. Isoform 2 is overexpressed in scirrhous gastric carcinoma.

Gene expression databases

BgeeiENSG00000104415.
CleanExiHS_WISP1.
ExpressionAtlasiO95388. baseline and differential.
GenevisibleiO95388. HS.

Organism-specific databases

HPAiCAB012205.
HPA007121.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114367. 1 interactor.
IntActiO95388. 1 interactor.
STRINGi9606.ENSP00000250160.

Structurei

3D structure databases

ProteinModelPortaliO95388.
SMRiO95388.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 118IGFBP N-terminalPROSITE-ProRule annotationAdd BLAST79
Domaini121 – 186VWFCPROSITE-ProRule annotationAdd BLAST66
Domaini215 – 260TSP type-1PROSITE-ProRule annotationAdd BLAST46
Domaini273 – 347CTCKPROSITE-ProRule annotationAdd BLAST75

Sequence similaritiesi

Belongs to the CCN family.Curated
Contains 1 CTCK (C-terminal cystine knot-like) domain.PROSITE-ProRule annotation
Contains 1 IGFBP N-terminal domain.PROSITE-ProRule annotation
Contains 1 TSP type-1 domain.PROSITE-ProRule annotation
Contains 1 VWFC domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IH8M. Eukaryota.
ENOG410ZWR5. LUCA.
GeneTreeiENSGT00760000119225.
HOGENOMiHOG000231462.
HOVERGENiHBG000635.
InParanoidiO95388.
OMAiVDITKHI.
OrthoDBiEOG091G0SQP.
PhylomeDBiO95388.
TreeFamiTF326070.

Family and domain databases

InterProiIPR006207. Cys_knot_C.
IPR006208. Glyco_hormone_CN.
IPR009030. Growth_fac_rcpt_.
IPR000867. IGFBP-like.
IPR012395. IGFBP_CNN.
IPR017891. Insulin_GF-bd_Cys-rich_CS.
IPR000884. TSP1_rpt.
IPR001007. VWF_dom.
[Graphical view]
PfamiPF00007. Cys_knot. 1 hit.
PF00219. IGFBP. 1 hit.
PF00090. TSP_1. 1 hit.
PF00093. VWC. 1 hit.
[Graphical view]
PIRSFiPIRSF036495. IGFBP_rP_CNN. 1 hit.
SMARTiSM00041. CT. 1 hit.
SM00121. IB. 1 hit.
SM00209. TSP1. 1 hit.
SM00214. VWC. 1 hit.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 1 hit.
SSF82895. SSF82895. 1 hit.
PROSITEiPS01185. CTCK_1. 1 hit.
PS01225. CTCK_2. 1 hit.
PS00222. IGFBP_N_1. 1 hit.
PS51323. IGFBP_N_2. 1 hit.
PS50092. TSP1. 1 hit.
PS01208. VWFC_1. 1 hit.
PS50184. VWFC_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95388-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRWFLPWTLA AVTAAAASTV LATALSPAPT TMDFTPAPLE DTSSRPQFCK
60 70 80 90 100
WPCECPPSPP RCPLGVSLIT DGCECCKMCA QQLGDNCTEA AICDPHRGLY
110 120 130 140 150
CDYSGDRPRY AIGVCAQVVG VGCVLDGVRY NNGQSFQPNC KYNCTCIDGA
160 170 180 190 200
VGCTPLCLRV RPPRLWCPHP RRVSIPGHCC EQWVCEDDAK RPRKTAPRDT
210 220 230 240 250
GAFDAVGEVE AWHRNCIAYT SPWSPCSTSC GLGVSTRISN VNAQCWPEQE
260 270 280 290 300
SRLCNLRPCD VDIHTLIKAG KKCLAVYQPE ASMNFTLAGC ISTRSYQPKY
310 320 330 340 350
CGVCMDNRCC IPYKSKTIDV SFQCPDGLGF SRQVLWINAC FCNLSCRNPN
360
DIFADLESYP DFSEIAN
Length:367
Mass (Da):40,331
Last modified:May 1, 1999 - v1
Checksum:i9F29CA94D69C0502
GO
Isoform 2 (identifier: O95388-2) [UniParc]FASTAAdd to basket
Also known as: WISP1v

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: Q → H
     118-204: Missing.

Show »
Length:280
Mass (Da):30,697
Checksum:i26B254D4A060738E
GO
Isoform 3 (identifier: O95388-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-268: Missing.

Show »
Length:122
Mass (Da):13,490
Checksum:iBFFABA376CB30BE8
GO
Isoform 4 (identifier: O95388-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-155: QVVGVGCVLD...CIDGAVGCTP → RREEVSGCVP...TQVLWSLHGQ
     156-367: Missing.

Show »
Length:155
Mass (Da):16,802
Checksum:i68B64C21B83E7E40
GO
Isoform 5 (identifier: O95388-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MRWFLPWTLAAVTAAAASTVLATALSPAPTT → MPVPLTSRHEVVPALDAGSSDSSSRQHRPGH
     32-203: Missing.

Show »
Length:195
Mass (Da):21,550
Checksum:i09116547C1D5E824
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti91A → V in AAP43926 (Ref. 3) Curated1
Isoform 4 (identifier: O95388-4)
Sequence conflicti155Q → QQVLHPLQV in AAP43926 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061265205A → S.Corresponds to variant rs35513885dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0477061 – 31MRWFL…PAPTT → MPVPLTSRHEVVPALDAGSS DSSSRQHRPGH in isoform 5. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_04201024 – 268Missing in isoform 3. 1 PublicationAdd BLAST245
Alternative sequenceiVSP_04770732 – 203Missing in isoform 5. 2 PublicationsAdd BLAST172
Alternative sequenceiVSP_045958117 – 155QVVGV…VGCTP → RREEVSGCVPARGIHELHTC GLHQHTLLSTQVLWSLHGQ in isoform 4. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_008008117Q → H in isoform 2. 1 Publication1
Alternative sequenceiVSP_008009118 – 204Missing in isoform 2. 1 PublicationAdd BLAST87
Alternative sequenceiVSP_045959156 – 367Missing in isoform 4. 1 PublicationAdd BLAST212

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF100779 mRNA. Translation: AAC96321.1.
AB034725 mRNA. Translation: BAB17849.1.
AY196486 mRNA. Translation: AAP43924.1.
AY196487 mRNA. Translation: AAP43925.1.
AY196488 mRNA. Translation: AAP43926.1.
AK293031 mRNA. Translation: BAF85720.1.
AK301508 mRNA. Translation: BAG63017.1.
AF192304 Genomic DNA. No translation available.
CH471060 Genomic DNA. Translation: EAW92162.1.
BC074840 mRNA. Translation: AAH74840.1.
BC074841 mRNA. Translation: AAH74841.1.
CCDSiCCDS56555.1. [O95388-4]
CCDS56556.1. [O95388-3]
CCDS6371.1. [O95388-1]
CCDS6372.1. [O95388-2]
RefSeqiNP_001191798.1. NM_001204869.1. [O95388-4]
NP_001191799.1. NM_001204870.1. [O95388-3]
NP_003873.1. NM_003882.3. [O95388-1]
NP_543028.1. NM_080838.2. [O95388-2]
UniGeneiHs.492974.

Genome annotation databases

EnsembliENST00000220856; ENSP00000220856; ENSG00000104415. [O95388-2]
ENST00000250160; ENSP00000250160; ENSG00000104415. [O95388-1]
ENST00000517423; ENSP00000427744; ENSG00000104415. [O95388-4]
ENST00000519433; ENSP00000429185; ENSG00000104415. [O95388-3]
GeneIDi8840.
KEGGihsa:8840.
UCSCiuc003yub.4. human. [O95388-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF100779 mRNA. Translation: AAC96321.1.
AB034725 mRNA. Translation: BAB17849.1.
AY196486 mRNA. Translation: AAP43924.1.
AY196487 mRNA. Translation: AAP43925.1.
AY196488 mRNA. Translation: AAP43926.1.
AK293031 mRNA. Translation: BAF85720.1.
AK301508 mRNA. Translation: BAG63017.1.
AF192304 Genomic DNA. No translation available.
CH471060 Genomic DNA. Translation: EAW92162.1.
BC074840 mRNA. Translation: AAH74840.1.
BC074841 mRNA. Translation: AAH74841.1.
CCDSiCCDS56555.1. [O95388-4]
CCDS56556.1. [O95388-3]
CCDS6371.1. [O95388-1]
CCDS6372.1. [O95388-2]
RefSeqiNP_001191798.1. NM_001204869.1. [O95388-4]
NP_001191799.1. NM_001204870.1. [O95388-3]
NP_003873.1. NM_003882.3. [O95388-1]
NP_543028.1. NM_080838.2. [O95388-2]
UniGeneiHs.492974.

3D structure databases

ProteinModelPortaliO95388.
SMRiO95388.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114367. 1 interactor.
IntActiO95388. 1 interactor.
STRINGi9606.ENSP00000250160.

PTM databases

iPTMnetiO95388.
PhosphoSitePlusiO95388.

Polymorphism and mutation databases

BioMutaiWISP1.

Proteomic databases

PaxDbiO95388.
PeptideAtlasiO95388.
PRIDEiO95388.

Protocols and materials databases

DNASUi8840.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000220856; ENSP00000220856; ENSG00000104415. [O95388-2]
ENST00000250160; ENSP00000250160; ENSG00000104415. [O95388-1]
ENST00000517423; ENSP00000427744; ENSG00000104415. [O95388-4]
ENST00000519433; ENSP00000429185; ENSG00000104415. [O95388-3]
GeneIDi8840.
KEGGihsa:8840.
UCSCiuc003yub.4. human. [O95388-1]

Organism-specific databases

CTDi8840.
DisGeNETi8840.
GeneCardsiWISP1.
HGNCiHGNC:12769. WISP1.
HPAiCAB012205.
HPA007121.
MIMi603398. gene.
neXtProtiNX_O95388.
OpenTargetsiENSG00000104415.
PharmGKBiPA37372.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IH8M. Eukaryota.
ENOG410ZWR5. LUCA.
GeneTreeiENSGT00760000119225.
HOGENOMiHOG000231462.
HOVERGENiHBG000635.
InParanoidiO95388.
OMAiVDITKHI.
OrthoDBiEOG091G0SQP.
PhylomeDBiO95388.
TreeFamiTF326070.

Miscellaneous databases

ChiTaRSiWISP1. human.
GeneWikiiWNT1-inducible-signaling_pathway_protein_1.
GenomeRNAii8840.
PROiO95388.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000104415.
CleanExiHS_WISP1.
ExpressionAtlasiO95388. baseline and differential.
GenevisibleiO95388. HS.

Family and domain databases

InterProiIPR006207. Cys_knot_C.
IPR006208. Glyco_hormone_CN.
IPR009030. Growth_fac_rcpt_.
IPR000867. IGFBP-like.
IPR012395. IGFBP_CNN.
IPR017891. Insulin_GF-bd_Cys-rich_CS.
IPR000884. TSP1_rpt.
IPR001007. VWF_dom.
[Graphical view]
PfamiPF00007. Cys_knot. 1 hit.
PF00219. IGFBP. 1 hit.
PF00090. TSP_1. 1 hit.
PF00093. VWC. 1 hit.
[Graphical view]
PIRSFiPIRSF036495. IGFBP_rP_CNN. 1 hit.
SMARTiSM00041. CT. 1 hit.
SM00121. IB. 1 hit.
SM00209. TSP1. 1 hit.
SM00214. VWC. 1 hit.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 1 hit.
SSF82895. SSF82895. 1 hit.
PROSITEiPS01185. CTCK_1. 1 hit.
PS01225. CTCK_2. 1 hit.
PS00222. IGFBP_N_1. 1 hit.
PS51323. IGFBP_N_2. 1 hit.
PS50092. TSP1. 1 hit.
PS01208. VWFC_1. 1 hit.
PS50184. VWFC_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiWISP1_HUMAN
AccessioniPrimary (citable) accession number: O95388
Secondary accession number(s): A8KAG6
, E7EMM5, Q5JBS6, Q5JBS7, Q5JBS8, Q9HCS3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: May 1, 1999
Last modified: November 30, 2016
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.