SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O95302

- FKBP9_HUMAN

UniProt

O95302 - FKBP9_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Peptidyl-prolyl cis-trans isomerase FKBP9

Gene
FKBP9, FKBP60, FKBP63
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

PPIases accelerate the folding of proteins during protein synthesis.

Catalytic activityi

Peptidylproline (omega=180) = peptidylproline (omega=0).

Enzyme regulationi

Inhibited by FK506 By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi501 – 513131 Reviewed predictionAdd
BLAST
Calcium bindingi546 – 557122 Reviewed predictionAdd
BLAST

GO - Molecular functioni

  1. calcium ion binding Source: UniProtKB
  2. FK506 binding Source: RefGenome
  3. peptidyl-prolyl cis-trans isomerase activity Source: RefGenome

GO - Biological processi

  1. chaperone-mediated protein folding Source: RefGenome
  2. protein folding Source: UniProtKB
  3. protein peptidyl-prolyl isomerization Source: RefGenome
Complete GO annotation...

Keywords - Molecular functioni

Isomerase, Rotamase

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_16907. Association of TriC/CCT with target proteins during biosynthesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase FKBP9 (EC:5.2.1.8)
Short name:
PPIase FKBP9
Alternative name(s):
63 kDa FK506-binding protein
Short name:
63 kDa FKBP
Short name:
FKBP-63
FK506-binding protein 9
Short name:
FKBP-9
Rotamase
Gene namesi
Name:FKBP9
Synonyms:FKBP60, FKBP63
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:3725. FKBP9.

Subcellular locationi

Endoplasmic reticulum By similarity

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB
  2. endoplasmic reticulum membrane Source: RefGenome
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28166.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424 Reviewed predictionAdd
BLAST
Chaini25 – 570546Peptidyl-prolyl cis-trans isomerase FKBP9PRO_0000045760Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi174 – 1741N-linked (GlcNAc...)1 Publication
Glycosylationi286 – 2861N-linked (GlcNAc...)1 Publication
Glycosylationi302 – 3021N-linked (GlcNAc...) Reviewed prediction
Glycosylationi397 – 3971N-linked (GlcNAc...)1 Publication

Post-translational modificationi

Phosphorylated By similarity.

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiO95302.
PRIDEiO95302.

PTM databases

PhosphoSiteiO95302.

Expressioni

Gene expression databases

ArrayExpressiO95302.
BgeeiO95302.
CleanExiHS_FKBP9.
GenevestigatoriO95302.

Organism-specific databases

HPAiHPA012595.

Interactioni

Protein-protein interaction databases

BioGridi116456. 22 interactions.
IntActiO95302. 1 interaction.
STRINGi9606.ENSP00000242209.

Structurei

3D structure databases

ProteinModelPortaliO95302.
SMRiO95302. Positions 22-564.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini54 – 14289PPIase FKBP-type 1Add
BLAST
Domaini166 – 25489PPIase FKBP-type 2Add
BLAST
Domaini278 – 36588PPIase FKBP-type 3Add
BLAST
Domaini389 – 47789PPIase FKBP-type 4Add
BLAST
Domaini488 – 52336EF-hand 1Add
BLAST
Domaini533 – 56836EF-hand 2Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi567 – 5704Prevents secretion from ER Reviewed prediction

Sequence similaritiesi

Contains 2 EF-hand domains.

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

HOVERGENiHBG051620.
InParanoidiO95302.
KOiK09575.
OrthoDBiEOG7T1R9S.
PhylomeDBiO95302.
TreeFamiTF105296.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR023566. PPIase_FKBP.
IPR001179. PPIase_FKBP_dom.
[Graphical view]
PANTHERiPTHR10516. PTHR10516. 1 hit.
PfamiPF00254. FKBP_C. 4 hits.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
PS00014. ER_TARGET. 1 hit.
PS50059. FKBP_PPIASE. 4 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O95302-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAFRGWRPPP PPLLLLLLWV TGQAAPVAGL GSDAELQIER RFVPDECPRT    50
VRSGDFVRYH YVGTFPDGQK FDSSYDRDST FNVFVGKGQL ITGMDQALVG 100
MCVNERRFVK IPPKLAYGNE GVSGVIPPNS VLHFDVLLMD IWNSEDQVQI 150
HTYFKPPSCP RTIQVSDFVR YHYNGTFLDG TLFDSSHNRM KTYDTYVGIG 200
WLIPGMDKGL LGMCVGEKRI ITIPPFLAYG EDGDGKDIPG QASLVFDVAL 250
LDLHNPKDSI SIENKVVPEN CERISQSGDF LRYHYNGTLL DGTLFDSSYS 300
RNRTFDTYIG QGYVIPGMDE GLLGVCIGEK RRIVVPPHLG YGEEGRGNIP 350
GSAVLVFDIH VIDFHNPSDS ISITSHYKPP DCSVLSKKGD YLKYHYNASL 400
LDGTLLDSTW NLGKTYNIVL GSGQVVLGMD MGLREMCVGE KRTVIIPPHL 450
GYGEAGVDGE VPGSAVLVFD IELLELVAGL PEGYMFIWNG EVSPNLFEEI 500
DKDGNGEVLL EEFSEYIHAQ VASGKGKLAP GFDAELIVKN MFTNQDRNGD 550
GKVTAEEFKL KDQEAKHDEL 570
Length:570
Mass (Da):63,084
Last modified:January 10, 2006 - v2
Checksum:iE1F44A2FA6E112F8
GO
Isoform 2 (identifier: O95302-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-234: MAFRGWRPPP...PFLAYGEDGD → MA

Show »
Length:338
Mass (Da):37,047
Checksum:i2DAFD52806381800
GO
Isoform 3 (identifier: O95302-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-73: S → SRYWDTAEDKADKSPCPQVRVGVNTSPSCRLKQKGVGIYWKDLQFLVRVQNHGL

Show »
Length:623
Mass (Da):69,155
Checksum:i85E8B433A3631692
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 234234MAFRG…GEDGD → MA in isoform 2. VSP_054825Add
BLAST
Alternative sequencei73 – 731S → SRYWDTAEDKADKSPCPQVR VGVNTSPSCRLKQKGVGIYW KDLQFLVRVQNHGL in isoform 3. VSP_054826

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK128597 mRNA. Translation: BAG54697.1.
AK293440 mRNA. Translation: BAH11505.1.
AK300328 mRNA. Translation: BAH13259.1.
AC083863 Genomic DNA. No translation available.
BC007443 mRNA. Translation: AAH07443.2.
BC064418 mRNA. Translation: AAH64418.1.
BC072422 mRNA. Translation: AAH72422.1.
BC101723 mRNA. Translation: AAI01724.1.
BC112053 mRNA. Translation: AAI12054.1.
AF089745 mRNA. Translation: AAC78853.1.
CCDSiCCDS5439.1. [O95302-1]
CCDS64622.1. [O95302-3]
CCDS64623.1. [O95302-2]
RefSeqiNP_001271270.1. NM_001284341.1. [O95302-3]
NP_001271272.1. NM_001284343.1. [O95302-2]
NP_009201.2. NM_007270.4. [O95302-1]
UniGeneiHs.103934.

Genome annotation databases

EnsembliENST00000242209; ENSP00000242209; ENSG00000122642.
ENST00000490776; ENSP00000441317; ENSG00000122642.
ENST00000538336; ENSP00000439250; ENSG00000122642.
GeneIDi11328.
KEGGihsa:11328.
UCSCiuc003tdh.3. human. [O95302-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK128597 mRNA. Translation: BAG54697.1 .
AK293440 mRNA. Translation: BAH11505.1 .
AK300328 mRNA. Translation: BAH13259.1 .
AC083863 Genomic DNA. No translation available.
BC007443 mRNA. Translation: AAH07443.2 .
BC064418 mRNA. Translation: AAH64418.1 .
BC072422 mRNA. Translation: AAH72422.1 .
BC101723 mRNA. Translation: AAI01724.1 .
BC112053 mRNA. Translation: AAI12054.1 .
AF089745 mRNA. Translation: AAC78853.1 .
CCDSi CCDS5439.1. [O95302-1 ]
CCDS64622.1. [O95302-3 ]
CCDS64623.1. [O95302-2 ]
RefSeqi NP_001271270.1. NM_001284341.1. [O95302-3 ]
NP_001271272.1. NM_001284343.1. [O95302-2 ]
NP_009201.2. NM_007270.4. [O95302-1 ]
UniGenei Hs.103934.

3D structure databases

ProteinModelPortali O95302.
SMRi O95302. Positions 22-564.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116456. 22 interactions.
IntActi O95302. 1 interaction.
STRINGi 9606.ENSP00000242209.

PTM databases

PhosphoSitei O95302.

Proteomic databases

MaxQBi O95302.
PRIDEi O95302.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000242209 ; ENSP00000242209 ; ENSG00000122642 .
ENST00000490776 ; ENSP00000441317 ; ENSG00000122642 .
ENST00000538336 ; ENSP00000439250 ; ENSG00000122642 .
GeneIDi 11328.
KEGGi hsa:11328.
UCSCi uc003tdh.3. human. [O95302-1 ]

Organism-specific databases

CTDi 11328.
GeneCardsi GC07P032997.
H-InvDB HIX0006586.
HIX0167892.
HGNCi HGNC:3725. FKBP9.
HPAi HPA012595.
neXtProti NX_O95302.
PharmGKBi PA28166.
GenAtlasi Search...

Phylogenomic databases

HOVERGENi HBG051620.
InParanoidi O95302.
KOi K09575.
OrthoDBi EOG7T1R9S.
PhylomeDBi O95302.
TreeFami TF105296.

Enzyme and pathway databases

Reactomei REACT_16907. Association of TriC/CCT with target proteins during biosynthesis.

Miscellaneous databases

GeneWikii FKBP9.
GenomeRNAii 11328.
NextBioi 35478724.
PROi O95302.

Gene expression databases

ArrayExpressi O95302.
Bgeei O95302.
CleanExi HS_FKBP9.
Genevestigatori O95302.

Family and domain databases

Gene3Di 1.10.238.10. 1 hit.
InterProi IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR023566. PPIase_FKBP.
IPR001179. PPIase_FKBP_dom.
[Graphical view ]
PANTHERi PTHR10516. PTHR10516. 1 hit.
Pfami PF00254. FKBP_C. 4 hits.
[Graphical view ]
SMARTi SM00054. EFh. 2 hits.
[Graphical view ]
PROSITEi PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
PS00014. ER_TARGET. 1 hit.
PS50059. FKBP_PPIASE. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Trachea.
  2. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney, Liver, Lung and PNS.
  4. "Biochemical analysis of mouse FKBP60, a novel member of the FKBP family."
    Shadidy M., Caubit X., Olsen R., Seternes O.M., Moens U., Krauss S.
    Biochim. Biophys. Acta 1446:295-307(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 54-570 (ISOFORM 1).
  5. "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry."
    Zhang H., Li X.-J., Martin D.B., Aebersold R.
    Nat. Biotechnol. 21:660-666(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT ASN-174; ASN-286 AND ASN-397.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiFKBP9_HUMAN
AccessioniPrimary (citable) accession number: O95302
Secondary accession number(s): B3KY35
, B7Z1G9, B7Z6H3, Q2M2A1, Q3MIR7, Q6IN76, Q6P2N1, Q96EX5, Q96IJ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2002
Last sequence update: January 10, 2006
Last modified: September 3, 2014
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi