Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95302

- FKBP9_HUMAN

UniProt

O95302 - FKBP9_HUMAN

Protein

Peptidyl-prolyl cis-trans isomerase FKBP9

Gene

FKBP9

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 2 (10 Jan 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    PPIases accelerate the folding of proteins during protein synthesis.

    Catalytic activityi

    Peptidylproline (omega=180) = peptidylproline (omega=0).

    Enzyme regulationi

    Inhibited by FK506.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Calcium bindingi501 – 513131PROSITE-ProRule annotationAdd
    BLAST
    Calcium bindingi546 – 557122PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. calcium ion binding Source: UniProtKB
    2. FK506 binding Source: RefGenome
    3. peptidyl-prolyl cis-trans isomerase activity Source: RefGenome

    GO - Biological processi

    1. chaperone-mediated protein folding Source: RefGenome
    2. protein folding Source: UniProtKB
    3. protein peptidyl-prolyl isomerization Source: RefGenome

    Keywords - Molecular functioni

    Isomerase, Rotamase

    Keywords - Ligandi

    Calcium, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_16907. Association of TriC/CCT with target proteins during biosynthesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Peptidyl-prolyl cis-trans isomerase FKBP9 (EC:5.2.1.8)
    Short name:
    PPIase FKBP9
    Alternative name(s):
    63 kDa FK506-binding protein
    Short name:
    63 kDa FKBP
    Short name:
    FKBP-63
    FK506-binding protein 9
    Short name:
    FKBP-9
    Rotamase
    Gene namesi
    Name:FKBP9
    Synonyms:FKBP60, FKBP63
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:3725. FKBP9.

    Subcellular locationi

    Endoplasmic reticulum PROSITE-ProRule annotation

    GO - Cellular componenti

    1. endoplasmic reticulum Source: UniProtKB
    2. endoplasmic reticulum membrane Source: RefGenome

    Keywords - Cellular componenti

    Endoplasmic reticulum

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA28166.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424Sequence AnalysisAdd
    BLAST
    Chaini25 – 570546Peptidyl-prolyl cis-trans isomerase FKBP9PRO_0000045760Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi174 – 1741N-linked (GlcNAc...)1 Publication
    Glycosylationi286 – 2861N-linked (GlcNAc...)1 Publication
    Glycosylationi302 – 3021N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi397 – 3971N-linked (GlcNAc...)1 Publication

    Post-translational modificationi

    Phosphorylated.By similarity

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiO95302.
    PRIDEiO95302.

    PTM databases

    PhosphoSiteiO95302.

    Expressioni

    Gene expression databases

    ArrayExpressiO95302.
    BgeeiO95302.
    CleanExiHS_FKBP9.
    GenevestigatoriO95302.

    Organism-specific databases

    HPAiHPA012595.

    Interactioni

    Protein-protein interaction databases

    BioGridi116456. 22 interactions.
    IntActiO95302. 1 interaction.
    STRINGi9606.ENSP00000242209.

    Structurei

    3D structure databases

    ProteinModelPortaliO95302.
    SMRiO95302. Positions 22-564.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini54 – 14289PPIase FKBP-type 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini166 – 25489PPIase FKBP-type 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini278 – 36588PPIase FKBP-type 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini389 – 47789PPIase FKBP-type 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini488 – 52336EF-hand 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini533 – 56836EF-hand 2PROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi567 – 5704Prevents secretion from ERPROSITE-ProRule annotation

    Sequence similaritiesi

    Contains 2 EF-hand domains.PROSITE-ProRule annotation
    Contains 4 PPIase FKBP-type domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal

    Phylogenomic databases

    HOVERGENiHBG051620.
    InParanoidiO95302.
    KOiK09575.
    OrthoDBiEOG7T1R9S.
    PhylomeDBiO95302.
    TreeFamiTF105296.

    Family and domain databases

    Gene3Di1.10.238.10. 1 hit.
    InterProiIPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR023566. PPIase_FKBP.
    IPR001179. PPIase_FKBP_dom.
    [Graphical view]
    PANTHERiPTHR10516. PTHR10516. 1 hit.
    PfamiPF00254. FKBP_C. 4 hits.
    [Graphical view]
    SMARTiSM00054. EFh. 2 hits.
    [Graphical view]
    PROSITEiPS00018. EF_HAND_1. 1 hit.
    PS50222. EF_HAND_2. 2 hits.
    PS00014. ER_TARGET. 1 hit.
    PS50059. FKBP_PPIASE. 4 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O95302-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAFRGWRPPP PPLLLLLLWV TGQAAPVAGL GSDAELQIER RFVPDECPRT    50
    VRSGDFVRYH YVGTFPDGQK FDSSYDRDST FNVFVGKGQL ITGMDQALVG 100
    MCVNERRFVK IPPKLAYGNE GVSGVIPPNS VLHFDVLLMD IWNSEDQVQI 150
    HTYFKPPSCP RTIQVSDFVR YHYNGTFLDG TLFDSSHNRM KTYDTYVGIG 200
    WLIPGMDKGL LGMCVGEKRI ITIPPFLAYG EDGDGKDIPG QASLVFDVAL 250
    LDLHNPKDSI SIENKVVPEN CERISQSGDF LRYHYNGTLL DGTLFDSSYS 300
    RNRTFDTYIG QGYVIPGMDE GLLGVCIGEK RRIVVPPHLG YGEEGRGNIP 350
    GSAVLVFDIH VIDFHNPSDS ISITSHYKPP DCSVLSKKGD YLKYHYNASL 400
    LDGTLLDSTW NLGKTYNIVL GSGQVVLGMD MGLREMCVGE KRTVIIPPHL 450
    GYGEAGVDGE VPGSAVLVFD IELLELVAGL PEGYMFIWNG EVSPNLFEEI 500
    DKDGNGEVLL EEFSEYIHAQ VASGKGKLAP GFDAELIVKN MFTNQDRNGD 550
    GKVTAEEFKL KDQEAKHDEL 570
    Length:570
    Mass (Da):63,084
    Last modified:January 10, 2006 - v2
    Checksum:iE1F44A2FA6E112F8
    GO
    Isoform 2 (identifier: O95302-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-234: MAFRGWRPPP...PFLAYGEDGD → MA

    Show »
    Length:338
    Mass (Da):37,047
    Checksum:i2DAFD52806381800
    GO
    Isoform 3 (identifier: O95302-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         73-73: S → SRYWDTAEDKADKSPCPQVRVGVNTSPSCRLKQKGVGIYWKDLQFLVRVQNHGL

    Show »
    Length:623
    Mass (Da):69,155
    Checksum:i85E8B433A3631692
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 234234MAFRG…GEDGD → MA in isoform 2. 1 PublicationVSP_054825Add
    BLAST
    Alternative sequencei73 – 731S → SRYWDTAEDKADKSPCPQVR VGVNTSPSCRLKQKGVGIYW KDLQFLVRVQNHGL in isoform 3. 1 PublicationVSP_054826

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK128597 mRNA. Translation: BAG54697.1.
    AK293440 mRNA. Translation: BAH11505.1.
    AK300328 mRNA. Translation: BAH13259.1.
    AC083863 Genomic DNA. No translation available.
    BC007443 mRNA. Translation: AAH07443.2.
    BC064418 mRNA. Translation: AAH64418.1.
    BC072422 mRNA. Translation: AAH72422.1.
    BC101723 mRNA. Translation: AAI01724.1.
    BC112053 mRNA. Translation: AAI12054.1.
    AF089745 mRNA. Translation: AAC78853.1.
    CCDSiCCDS5439.1. [O95302-1]
    CCDS64622.1. [O95302-3]
    CCDS64623.1. [O95302-2]
    RefSeqiNP_001271270.1. NM_001284341.1. [O95302-3]
    NP_001271272.1. NM_001284343.1. [O95302-2]
    NP_009201.2. NM_007270.4. [O95302-1]
    UniGeneiHs.103934.

    Genome annotation databases

    EnsembliENST00000242209; ENSP00000242209; ENSG00000122642. [O95302-1]
    ENST00000490776; ENSP00000441317; ENSG00000122642. [O95302-2]
    ENST00000538336; ENSP00000439250; ENSG00000122642. [O95302-3]
    GeneIDi11328.
    KEGGihsa:11328.
    UCSCiuc003tdh.3. human. [O95302-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK128597 mRNA. Translation: BAG54697.1 .
    AK293440 mRNA. Translation: BAH11505.1 .
    AK300328 mRNA. Translation: BAH13259.1 .
    AC083863 Genomic DNA. No translation available.
    BC007443 mRNA. Translation: AAH07443.2 .
    BC064418 mRNA. Translation: AAH64418.1 .
    BC072422 mRNA. Translation: AAH72422.1 .
    BC101723 mRNA. Translation: AAI01724.1 .
    BC112053 mRNA. Translation: AAI12054.1 .
    AF089745 mRNA. Translation: AAC78853.1 .
    CCDSi CCDS5439.1. [O95302-1 ]
    CCDS64622.1. [O95302-3 ]
    CCDS64623.1. [O95302-2 ]
    RefSeqi NP_001271270.1. NM_001284341.1. [O95302-3 ]
    NP_001271272.1. NM_001284343.1. [O95302-2 ]
    NP_009201.2. NM_007270.4. [O95302-1 ]
    UniGenei Hs.103934.

    3D structure databases

    ProteinModelPortali O95302.
    SMRi O95302. Positions 22-564.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116456. 22 interactions.
    IntActi O95302. 1 interaction.
    STRINGi 9606.ENSP00000242209.

    PTM databases

    PhosphoSitei O95302.

    Proteomic databases

    MaxQBi O95302.
    PRIDEi O95302.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000242209 ; ENSP00000242209 ; ENSG00000122642 . [O95302-1 ]
    ENST00000490776 ; ENSP00000441317 ; ENSG00000122642 . [O95302-2 ]
    ENST00000538336 ; ENSP00000439250 ; ENSG00000122642 . [O95302-3 ]
    GeneIDi 11328.
    KEGGi hsa:11328.
    UCSCi uc003tdh.3. human. [O95302-1 ]

    Organism-specific databases

    CTDi 11328.
    GeneCardsi GC07P032997.
    H-InvDB HIX0006586.
    HIX0167892.
    HGNCi HGNC:3725. FKBP9.
    HPAi HPA012595.
    neXtProti NX_O95302.
    PharmGKBi PA28166.
    GenAtlasi Search...

    Phylogenomic databases

    HOVERGENi HBG051620.
    InParanoidi O95302.
    KOi K09575.
    OrthoDBi EOG7T1R9S.
    PhylomeDBi O95302.
    TreeFami TF105296.

    Enzyme and pathway databases

    Reactomei REACT_16907. Association of TriC/CCT with target proteins during biosynthesis.

    Miscellaneous databases

    GeneWikii FKBP9.
    GenomeRNAii 11328.
    NextBioi 35478724.
    PROi O95302.

    Gene expression databases

    ArrayExpressi O95302.
    Bgeei O95302.
    CleanExi HS_FKBP9.
    Genevestigatori O95302.

    Family and domain databases

    Gene3Di 1.10.238.10. 1 hit.
    InterProi IPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR023566. PPIase_FKBP.
    IPR001179. PPIase_FKBP_dom.
    [Graphical view ]
    PANTHERi PTHR10516. PTHR10516. 1 hit.
    Pfami PF00254. FKBP_C. 4 hits.
    [Graphical view ]
    SMARTi SM00054. EFh. 2 hits.
    [Graphical view ]
    PROSITEi PS00018. EF_HAND_1. 1 hit.
    PS50222. EF_HAND_2. 2 hits.
    PS00014. ER_TARGET. 1 hit.
    PS50059. FKBP_PPIASE. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: Trachea.
    2. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Kidney, Liver, Lung and PNS.
    4. "Biochemical analysis of mouse FKBP60, a novel member of the FKBP family."
      Shadidy M., Caubit X., Olsen R., Seternes O.M., Moens U., Krauss S.
      Biochim. Biophys. Acta 1446:295-307(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 54-570 (ISOFORM 1).
    5. "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry."
      Zhang H., Li X.-J., Martin D.B., Aebersold R.
      Nat. Biotechnol. 21:660-666(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION AT ASN-174; ASN-286 AND ASN-397.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiFKBP9_HUMAN
    AccessioniPrimary (citable) accession number: O95302
    Secondary accession number(s): B3KY35
    , B7Z1G9, B7Z6H3, Q2M2A1, Q3MIR7, Q6IN76, Q6P2N1, Q96EX5, Q96IJ9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 19, 2002
    Last sequence update: January 10, 2006
    Last modified: October 1, 2014
    This is version 132 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3