Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myelin protein zero-like protein 1

Gene

MPZL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cell surface receptor, which is involved in signal transduction processes. Recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2. Is a major receptor for concanavalin-A (ConA) and is involved in cellular signaling induced by ConA, which probably includes Src family tyrosine-protein kinases. Isoform 3 seems to have a dominant negative role; it blocks tyrosine phosphorylation of MPZL1 induced by ConA. Isoform 1, but not isoform 2 and isoform 3, may be involved in regulation of integrin-mediated cell motility.2 Publications

GO - Molecular functioni

  • structural molecule activity Source: ProtInc

GO - Biological processi

  • cell-cell signaling Source: ProtInc
  • transmembrane receptor protein tyrosine kinase signaling pathway Source: ProtInc
Complete GO annotation...

Enzyme and pathway databases

SignaLinkiO95297.
SIGNORiO95297.

Names & Taxonomyi

Protein namesi
Recommended name:
Myelin protein zero-like protein 1
Alternative name(s):
Protein zero-related
Gene namesi
Name:MPZL1
Synonyms:PZR
ORF Names:UNQ849/PRO1787
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:7226. MPZL1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini36 – 162127ExtracellularSequence analysisAdd
BLAST
Transmembranei163 – 18321HelicalSequence analysisAdd
BLAST
Topological domaini184 – 26986CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • cell surface Source: UniProtKB
  • focal adhesion Source: UniProtKB
  • integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi241 – 2411Y → F: Significantly decreases phosphorylation. Complete loss of phosphorylation; when associated with F-263. 1 Publication
Mutagenesisi263 – 2631Y → F: Significantly decreases phosphorylation. Complete loss of phosphorylation; when associated with F-241. 1 Publication

Organism-specific databases

PharmGKBiPA30931.

Polymorphism and mutation databases

BioMutaiMPZL1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3535Sequence analysisAdd
BLAST
Chaini36 – 269234Myelin protein zero-like protein 1PRO_0000240335Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi50 – 501N-linked (GlcNAc...)1 Publication
Disulfide bondi58 ↔ 135PROSITE-ProRule annotation
Glycosylationi130 – 1301N-linked (GlcNAc...)Sequence analysis
Modified residuei204 – 2041PhosphoserineCombined sources
Modified residuei206 – 2061PhosphoserineCombined sources
Modified residuei208 – 2081PhosphoserineCombined sources
Modified residuei210 – 2101PhosphoserineCombined sources
Modified residuei219 – 2191PhosphoserineCombined sources
Modified residuei221 – 2211PhosphoserineCombined sources
Modified residuei241 – 2411PhosphotyrosineCombined sources1 Publication
Modified residuei260 – 2601PhosphoserineCombined sources
Modified residuei263 – 2631PhosphotyrosineCombined sources1 Publication

Post-translational modificationi

Phosphorylated on tyrosine residues upon stimulation with pervanadate and concanavalin-A (ConA). Phosphorylation at Tyr-241 and Tyr-263 is required for interaction with PTPN11/SHP-2. Dephosphorylated by PTPN11/SHP-2 (in vitro).3 Publications
N-glycosylated.3 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiO95297.
MaxQBiO95297.
PaxDbiO95297.
PeptideAtlasiO95297.
PRIDEiO95297.
TopDownProteomicsiO95297-1. [O95297-1]

PTM databases

iPTMnetiO95297.
PhosphoSiteiO95297.

Expressioni

Tissue specificityi

Widely expressed with highest levels in heart, placenta, kidney and pancreas. Isoform 3 is relatively abundant in hematopoietic tissues and fetal liver. Isoform 1 and isoform 3 are expressed in CD14- PB monocytes and pre-B cell progenitors. Isoform 3 appears to be the major isoform in CD34- promyelocytic and promonocytic cells. During differentiation in monocytic cells, the expression level of isoform 3 decreases and that of isoform 1 increases. Isoform 1 is prominent in stromal cells and, to a lesser extent, in umbilical vein endothelial cells and erythroid progenitors. Isoform 2 is expressed in a erythroid progenitor cell line.3 Publications

Gene expression databases

BgeeiENSG00000197965.
CleanExiHS_MPZL1.
ExpressionAtlasiO95297. baseline and differential.
GenevisibleiO95297. HS.

Organism-specific databases

HPAiHPA026966.

Interactioni

Subunit structurei

Interacts with phosphorylated PTPN11/SHP-2.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
PTPN11Q061244EBI-963338,EBI-297779

Protein-protein interaction databases

BioGridi114486. 48 interactions.
IntActiO95297. 22 interactions.
MINTiMINT-5165144.
STRINGi9606.ENSP00000352513.

Structurei

3D structure databases

ProteinModelPortaliO95297.
SMRiO95297. Positions 40-157.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini36 – 146111Ig-like V-typeAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi239 – 2446ITIM motif 1
Motifi261 – 2666ITIM motif 2

Domaini

Sequence similaritiesi

Belongs to the myelin P0 protein family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IVXC. Eukaryota.
ENOG4111MDZ. LUCA.
GeneTreeiENSGT00640000091161.
HOGENOMiHOG000059672.
HOVERGENiHBG104511.
InParanoidiO95297.
KOiK06770.
OMAiHQGPVIY.
OrthoDBiEOG091G0H91.
PhylomeDBiO95297.
TreeFamiTF331728.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR029870. MPZL1.
IPR000920. Myelin_P0-rel.
[Graphical view]
PANTHERiPTHR13869. PTHR13869. 1 hit.
PTHR13869:SF19. PTHR13869:SF19. 1 hit.
PfamiPF07686. V-set. 1 hit.
[Graphical view]
PRINTSiPR00213. MYELINP0.
SMARTiSM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95297-1) [UniParc]FASTAAdd to basket
Also known as: MPZL1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAASAGAGAV IAAPDSRRWL WSVLAAALGL LTAGVSALEV YTPKEIFVAN
60 70 80 90 100
GTQGKLTCKF KSTSTTGGLT SVSWSFQPEG ADTTVSFFHY SQGQVYLGNY
110 120 130 140 150
PPFKDRISWA GDLDKKDASI NIENMQFIHN GTYICDVKNP PDIVVQPGHI
160 170 180 190 200
RLYVVEKENL PVFPVWVVVG IVTAVVLGLT LLISMILAVL YRRKNSKRDY
210 220 230 240 250
TGCSTSESLS PVKQAPRKSP SDTEGLVKSL PSGSHQGPVI YAQLDHSGGH
260
HSDKINKSES VVYADIRKN
Length:269
Mass (Da):29,082
Last modified:May 1, 1999 - v1
Checksum:iA1B299041EE59425
GO
Isoform 2 (identifier: O95297-2) [UniParc]FASTAAdd to basket
Also known as: PZR1a

The sequence of this isoform differs from the canonical sequence as follows:
     42-42: Missing.

Show »
Length:268
Mass (Da):28,981
Checksum:iC696D8EE3C297715
GO
Isoform 3 (identifier: O95297-3) [UniParc]FASTAAdd to basket
Also known as: PZR1b

The sequence of this isoform differs from the canonical sequence as follows:
     203-269: CSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN → AQSYMHS

Show »
Length:209
Mass (Da):22,761
Checksum:i18EC385959C88329
GO
Isoform 4 (identifier: O95297-4) [UniParc]FASTAAdd to basket
Also known as: MPZL1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-124: Missing.

Show »
Length:145
Mass (Da):15,947
Checksum:i64F88C2B041B87F8
GO
Isoform 5 (identifier: O95297-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-236: Missing.

Note: No experimental confirmation available.
Show »
Length:119
Mass (Da):12,354
Checksum:i56BDFA661BA6A9EB
GO

Sequence cautioni

The sequence CAI20144 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti42 – 421T → A in AAO14646 (PubMed:12410637).Curated
Sequence conflicti177 – 1771L → I in AAO14646 (PubMed:12410637).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 124124Missing in isoform 4. 1 PublicationVSP_019342Add
BLAST
Alternative sequencei42 – 421Missing in isoform 2. CuratedVSP_019343
Alternative sequencei87 – 236150Missing in isoform 5. 1 PublicationVSP_043341Add
BLAST
Alternative sequencei203 – 26967CSTSE…DIRKN → AQSYMHS in isoform 3. 2 PublicationsVSP_019344Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087020 mRNA. Translation: AAC72231.1.
AF092424 mRNA. Translation: AAD55346.1.
AF092425 mRNA. Translation: AAD55347.1.
AF095726 mRNA. Translation: AAF00083.1.
AF095727 mRNA. Translation: AAF00084.1.
AF239756 mRNA. Translation: AAF63499.1.
AF478447 mRNA. Translation: AAO14645.1.
AF478448 Genomic DNA. Translation: AAO14647.1.
AF478448 Genomic DNA. Translation: AAO14646.1.
AY359019 mRNA. Translation: AAQ89378.1.
AK297112 mRNA. Translation: BAH12501.1.
CR542160 mRNA. Translation: CAG46957.1.
AL356532, Z99943 Genomic DNA. Translation: CAC36033.2.
Z99943, AL356532 Genomic DNA. Translation: CAI20143.1.
Z99943 Genomic DNA. Translation: CAI20144.2. Sequence problems.
AL356532, Z99943 Genomic DNA. Translation: CAQ52583.1.
AL356532, Z99943 Genomic DNA. Translation: CAQ52584.1.
Z99943, AL356532 Genomic DNA. Translation: CAQ52610.1.
Z99943, AL356532 Genomic DNA. Translation: CAQ52611.1.
CH471067 Genomic DNA. Translation: EAW90800.1.
BC007881 mRNA. Translation: AAH07881.1.
CCDSiCCDS1264.1. [O95297-1]
CCDS44273.1. [O95297-3]
CCDS53425.1. [O95297-5]
RefSeqiNP_001139663.1. NM_001146191.1. [O95297-5]
NP_003944.1. NM_003953.5. [O95297-1]
NP_078845.3. NM_024569.4. [O95297-3]
UniGeneiHs.493919.

Genome annotation databases

EnsembliENST00000359523; ENSP00000352513; ENSG00000197965. [O95297-1]
ENST00000392121; ENSP00000375968; ENSG00000197965. [O95297-5]
ENST00000474859; ENSP00000420455; ENSG00000197965. [O95297-3]
GeneIDi9019.
KEGGihsa:9019.
UCSCiuc001geo.3. human. [O95297-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087020 mRNA. Translation: AAC72231.1.
AF092424 mRNA. Translation: AAD55346.1.
AF092425 mRNA. Translation: AAD55347.1.
AF095726 mRNA. Translation: AAF00083.1.
AF095727 mRNA. Translation: AAF00084.1.
AF239756 mRNA. Translation: AAF63499.1.
AF478447 mRNA. Translation: AAO14645.1.
AF478448 Genomic DNA. Translation: AAO14647.1.
AF478448 Genomic DNA. Translation: AAO14646.1.
AY359019 mRNA. Translation: AAQ89378.1.
AK297112 mRNA. Translation: BAH12501.1.
CR542160 mRNA. Translation: CAG46957.1.
AL356532, Z99943 Genomic DNA. Translation: CAC36033.2.
Z99943, AL356532 Genomic DNA. Translation: CAI20143.1.
Z99943 Genomic DNA. Translation: CAI20144.2. Sequence problems.
AL356532, Z99943 Genomic DNA. Translation: CAQ52583.1.
AL356532, Z99943 Genomic DNA. Translation: CAQ52584.1.
Z99943, AL356532 Genomic DNA. Translation: CAQ52610.1.
Z99943, AL356532 Genomic DNA. Translation: CAQ52611.1.
CH471067 Genomic DNA. Translation: EAW90800.1.
BC007881 mRNA. Translation: AAH07881.1.
CCDSiCCDS1264.1. [O95297-1]
CCDS44273.1. [O95297-3]
CCDS53425.1. [O95297-5]
RefSeqiNP_001139663.1. NM_001146191.1. [O95297-5]
NP_003944.1. NM_003953.5. [O95297-1]
NP_078845.3. NM_024569.4. [O95297-3]
UniGeneiHs.493919.

3D structure databases

ProteinModelPortaliO95297.
SMRiO95297. Positions 40-157.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114486. 48 interactions.
IntActiO95297. 22 interactions.
MINTiMINT-5165144.
STRINGi9606.ENSP00000352513.

PTM databases

iPTMnetiO95297.
PhosphoSiteiO95297.

Polymorphism and mutation databases

BioMutaiMPZL1.

Proteomic databases

EPDiO95297.
MaxQBiO95297.
PaxDbiO95297.
PeptideAtlasiO95297.
PRIDEiO95297.
TopDownProteomicsiO95297-1. [O95297-1]

Protocols and materials databases

DNASUi9019.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359523; ENSP00000352513; ENSG00000197965. [O95297-1]
ENST00000392121; ENSP00000375968; ENSG00000197965. [O95297-5]
ENST00000474859; ENSP00000420455; ENSG00000197965. [O95297-3]
GeneIDi9019.
KEGGihsa:9019.
UCSCiuc001geo.3. human. [O95297-1]

Organism-specific databases

CTDi9019.
GeneCardsiMPZL1.
H-InvDBHIX0001303.
HGNCiHGNC:7226. MPZL1.
HPAiHPA026966.
MIMi604376. gene.
neXtProtiNX_O95297.
PharmGKBiPA30931.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IVXC. Eukaryota.
ENOG4111MDZ. LUCA.
GeneTreeiENSGT00640000091161.
HOGENOMiHOG000059672.
HOVERGENiHBG104511.
InParanoidiO95297.
KOiK06770.
OMAiHQGPVIY.
OrthoDBiEOG091G0H91.
PhylomeDBiO95297.
TreeFamiTF331728.

Enzyme and pathway databases

SignaLinkiO95297.
SIGNORiO95297.

Miscellaneous databases

ChiTaRSiMPZL1. human.
GeneWikiiMPZL1.
GenomeRNAii9019.
PROiO95297.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000197965.
CleanExiHS_MPZL1.
ExpressionAtlasiO95297. baseline and differential.
GenevisibleiO95297. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR029870. MPZL1.
IPR000920. Myelin_P0-rel.
[Graphical view]
PANTHERiPTHR13869. PTHR13869. 1 hit.
PTHR13869:SF19. PTHR13869:SF19. 1 hit.
PfamiPF07686. V-set. 1 hit.
[Graphical view]
PRINTSiPR00213. MYELINP0.
SMARTiSM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMPZL1_HUMAN
AccessioniPrimary (citable) accession number: O95297
Secondary accession number(s): B2REB9
, B2REC0, Q5R332, Q8IX11, Q9BWZ3, Q9NYK4, Q9UL20
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: May 1, 1999
Last modified: September 7, 2016
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.