Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O95258 (UCP5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 127. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Brain mitochondrial carrier protein 1

Short name=BMCP-1
Alternative name(s):
Mitochondrial uncoupling protein 5
Short name=UCP 5
Solute carrier family 25 member 14
Gene names
Name:SLC25A14
Synonyms:BMCP1, UCP5
ORF Names:UNQ791/PRO1682
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length325 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Participates in the mitochondrial proton leak measured in brain mitochondria.

Subcellular location

Mitochondrion inner membrane; Multi-pass membrane protein By similarity.

Tissue specificity

Mainly expressed in brain. Some expression in testis and pituitary. Ref.2

Sequence similarities

Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]

Contains 3 Solcar repeats.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O95258-1)

Also known as: UCP5L;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O95258-2)

Also known as: UCP5S;

The sequence of this isoform differs from the canonical sequence as follows:
     23-25: Missing.
Isoform 3 (identifier: O95258-3)

Also known as: UCP5SI;

The sequence of this isoform differs from the canonical sequence as follows:
     23-25: Missing.
     198-198: R → RCLCSKAVTGCVLWLMPVIPALWEANAGGSLE

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 325325Brain mitochondrial carrier protein 1
PRO_0000090677

Regions

Transmembrane38 – 5417Helical; Name=1; Potential
Transmembrane112 – 12817Helical; Name=2; Potential
Transmembrane141 – 16121Helical; Name=3; Potential
Transmembrane199 – 21517Helical; Name=4; Potential
Transmembrane240 – 25617Helical; Name=5; Potential
Transmembrane298 – 31518Helical; Name=6; Potential
Repeat42 – 13190Solcar 1
Repeat139 – 22486Solcar 2
Repeat233 – 32391Solcar 3

Natural variations

Alternative sequence23 – 253Missing in isoform 2 and isoform 3.
VSP_003272
Alternative sequence1981R → RCLCSKAVTGCVLWLMPVIP ALWEANAGGSLE in isoform 3.
VSP_003273
Natural variant551E → A.
Corresponds to variant rs2143598 [ dbSNP | Ensembl ].
VAR_050138

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (UCP5L) [UniParc].

Last modified May 1, 1999. Version 1.
Checksum: 0447E8E3B5374982

FASTA32536,202
        10         20         30         40         50         60 
MGIFPGIILI FLRVKFATAA VIVSGHQKST TVSHEMSGLN WKPFVYGGLA SIVAEFGTFP 

        70         80         90        100        110        120 
VDLTKTRLQV QGQSIDARFK EIKYRGMFHA LFRICKEEGV LALYSGIAPA LLRQASYGTI 

       130        140        150        160        170        180 
KIGIYQSLKR LFVERLEDET LLINMICGVV SGVISSTIAN PTDVLKIRMQ AQGSLFQGSM 

       190        200        210        220        230        240 
IGSFIDIYQQ EGTRGLWRGV VPTAQRAAIV VGVELPVYDI TKKHLILSGM MGDTILTHFV 

       250        260        270        280        290        300 
SSFTCGLAGA LASNPVDVVR TRMMNQRAIV GHVDLYKGTV DGILKMWKHE GFFALYKGFW 

       310        320 
PNWLRLGPWN IIFFITYEQL KRLQI 

« Hide

Isoform 2 (UCP5S) [UniParc].

Checksum: F3C186B06ADC0F6A
Show »

FASTA32235,958
Isoform 3 (UCP5SI) [UniParc].

Checksum: 8A66113E6FAE9C7B
Show »

FASTA35339,173

References

« Hide 'large scale' references
[1]"BMCP1, a novel mitochondrial carrier with high expression in the central nervous system of humans and rodents, and respiration uncoupling activity in recombinant yeast."
Sanchis D., Fleury C., Chomiki N., Goubern M., Huang Q., Neverova M., Gregoire F., Easlick J., Raimbault S., Levi-Meyrueis C., Miroux B., Collins S., Seldin M., Richard D., Warden C., Bouillaud F., Ricquier D.
J. Biol. Chem. 273:34611-34615(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Characterization of novel UCP5/BMCP1 isoforms and differential regulation of UCP4 and UCP5 expression through dietary or temperature manipulation."
Yu X.X., Mao W., Zhong A., Schow P., Brush J., Sherwood S.W., Adams S.H., Pan G.
FASEB J. 14:1611-1618(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
[3]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[4]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF078544 mRNA. Translation: AAD04346.1.
AF155809 mRNA. Translation: AAG29582.1.
AF155810 mRNA. Translation: AAG29583.1.
AF155811 mRNA. Translation: AAG29584.1.
AY358099 mRNA. Translation: AAQ88466.1.
AL035423 Genomic DNA. Translation: CAI42440.1.
AL035423 Genomic DNA. Translation: CAI42441.1.
AL035423 Genomic DNA. Translation: CAB41251.1.
CH471107 Genomic DNA. Translation: EAX11804.1.
BC119666 mRNA. Translation: AAI19667.1.
BC119667 mRNA. Translation: AAI19668.1.
CCDSCCDS14623.1. [O95258-1]
CCDS14624.1. [O95258-2]
RefSeqNP_001269124.1. NM_001282195.1. [O95258-1]
NP_001269125.1. NM_001282196.1. [O95258-2]
NP_001269126.1. NM_001282197.1. [O95258-3]
NP_001269127.1. NM_001282198.1.
UniGeneHs.194686.

3D structure databases

ProteinModelPortalO95258.
SMRO95258. Positions 44-322.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000218197.

Protein family/group databases

TCDB2.A.29.24.1. the mitochondrial carrier (mc) family.

PTM databases

PhosphoSiteO95258.

Proteomic databases

MaxQBO95258.
PaxDbO95258.
PRIDEO95258.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000218197; ENSP00000218197; ENSG00000102078. [O95258-1]
ENST00000339231; ENSP00000342797; ENSG00000102078. [O95258-3]
ENST00000361980; ENSP00000354455; ENSG00000102078. [O95258-2]
GeneID9016.
KEGGhsa:9016.
UCSCuc004evp.1. human. [O95258-1]
uc004evq.1. human. [O95258-2]
uc004evr.1. human. [O95258-3]

Organism-specific databases

CTD9016.
GeneCardsGC0XP129473.
HGNCHGNC:10984. SLC25A14.
MIM300242. gene.
neXtProtNX_O95258.
PharmGKBPA35860.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG240642.
HOGENOMHOG000165140.
HOVERGENHBG009528.
KOK15106.
OMAWRCLCSK.
PhylomeDBO95258.
TreeFamTF323211.

Gene expression databases

ArrayExpressO95258.
BgeeO95258.
CleanExHS_SLC25A14.
GenevestigatorO95258.

Family and domain databases

Gene3D1.50.40.10. 1 hit.
InterProIPR002030. Mit_uncoupling.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamPF00153. Mito_carr. 3 hits.
[Graphical view]
PRINTSPR00784. MTUNCOUPLING.
SUPFAMSSF103506. SSF103506. 1 hit.
PROSITEPS50920. SOLCAR. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiSLC25A14.
GenomeRNAi9016.
NextBio33781.
PROO95258.
SOURCESearch...

Entry information

Entry nameUCP5_HUMAN
AccessionPrimary (citable) accession number: O95258
Secondary accession number(s): D3DTG2 expand/collapse secondary AC list , Q0VDH7, Q9HC60, Q9HC61
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: July 9, 2014
This is version 127 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM