Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O95258

- UCP5_HUMAN

UniProt

O95258 - UCP5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Brain mitochondrial carrier protein 1

Gene

SLC25A14

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Participates in the mitochondrial proton leak measured in brain mitochondria.

GO - Biological processi

  1. aerobic respiration Source: ProtInc
  2. mitochondrial transport Source: InterPro
  3. transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Transport

Protein family/group databases

TCDBi2.A.29.24.1. the mitochondrial carrier (mc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Brain mitochondrial carrier protein 1
Short name:
BMCP-1
Alternative name(s):
Mitochondrial uncoupling protein 5
Short name:
UCP 5
Solute carrier family 25 member 14
Gene namesi
Name:SLC25A14
Synonyms:BMCP1, UCP5
ORF Names:UNQ791/PRO1682
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:10984. SLC25A14.

Subcellular locationi

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. mitochondrial inner membrane Source: UniProtKB-KW
  3. mitochondrion Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35860.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 325325Brain mitochondrial carrier protein 1PRO_0000090677Add
BLAST

Proteomic databases

MaxQBiO95258.
PaxDbiO95258.
PRIDEiO95258.

PTM databases

PhosphoSiteiO95258.

Expressioni

Tissue specificityi

Mainly expressed in brain. Some expression in testis and pituitary.1 Publication

Gene expression databases

BgeeiO95258.
CleanExiHS_SLC25A14.
ExpressionAtlasiO95258. baseline and differential.
GenevestigatoriO95258.

Interactioni

Protein-protein interaction databases

BioGridi114485. 2 interactions.
STRINGi9606.ENSP00000218197.

Structurei

3D structure databases

ProteinModelPortaliO95258.
SMRiO95258. Positions 44-322.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei38 – 5417Helical; Name=1Sequence AnalysisAdd
BLAST
Transmembranei112 – 12817Helical; Name=2Sequence AnalysisAdd
BLAST
Transmembranei141 – 16121Helical; Name=3Sequence AnalysisAdd
BLAST
Transmembranei199 – 21517Helical; Name=4Sequence AnalysisAdd
BLAST
Transmembranei240 – 25617Helical; Name=5Sequence AnalysisAdd
BLAST
Transmembranei298 – 31518Helical; Name=6Sequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati42 – 13190Solcar 1Add
BLAST
Repeati139 – 22486Solcar 2Add
BLAST
Repeati233 – 32391Solcar 3Add
BLAST

Sequence similaritiesi

Contains 3 Solcar repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG240642.
GeneTreeiENSGT00760000119170.
HOGENOMiHOG000165140.
HOVERGENiHBG009528.
InParanoidiO95258.
KOiK15106.
OMAiWRCLCSK.
PhylomeDBiO95258.
TreeFamiTF323211.

Family and domain databases

Gene3Di1.50.40.10. 1 hit.
InterProiIPR002030. Mit_uncoupling.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamiPF00153. Mito_carr. 3 hits.
[Graphical view]
PRINTSiPR00784. MTUNCOUPLING.
SUPFAMiSSF103506. SSF103506. 1 hit.
PROSITEiPS50920. SOLCAR. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O95258-1) [UniParc]FASTAAdd to Basket

Also known as: UCP5L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGIFPGIILI FLRVKFATAA VIVSGHQKST TVSHEMSGLN WKPFVYGGLA
60 70 80 90 100
SIVAEFGTFP VDLTKTRLQV QGQSIDARFK EIKYRGMFHA LFRICKEEGV
110 120 130 140 150
LALYSGIAPA LLRQASYGTI KIGIYQSLKR LFVERLEDET LLINMICGVV
160 170 180 190 200
SGVISSTIAN PTDVLKIRMQ AQGSLFQGSM IGSFIDIYQQ EGTRGLWRGV
210 220 230 240 250
VPTAQRAAIV VGVELPVYDI TKKHLILSGM MGDTILTHFV SSFTCGLAGA
260 270 280 290 300
LASNPVDVVR TRMMNQRAIV GHVDLYKGTV DGILKMWKHE GFFALYKGFW
310 320
PNWLRLGPWN IIFFITYEQL KRLQI
Length:325
Mass (Da):36,202
Last modified:May 1, 1999 - v1
Checksum:i0447E8E3B5374982
GO
Isoform 2 (identifier: O95258-2) [UniParc]FASTAAdd to Basket

Also known as: UCP5S

The sequence of this isoform differs from the canonical sequence as follows:
     23-25: Missing.

Show »
Length:322
Mass (Da):35,958
Checksum:iF3C186B06ADC0F6A
GO
Isoform 3 (identifier: O95258-3) [UniParc]FASTAAdd to Basket

Also known as: UCP5SI

The sequence of this isoform differs from the canonical sequence as follows:
     23-25: Missing.
     198-198: R → RCLCSKAVTGCVLWLMPVIPALWEANAGGSLE

Show »
Length:353
Mass (Da):39,173
Checksum:i8A66113E6FAE9C7B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti55 – 551E → A.
Corresponds to variant rs2143598 [ dbSNP | Ensembl ].
VAR_050138

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei23 – 253Missing in isoform 2 and isoform 3. CuratedVSP_003272
Alternative sequencei198 – 1981R → RCLCSKAVTGCVLWLMPVIP ALWEANAGGSLE in isoform 3. CuratedVSP_003273

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF078544 mRNA. Translation: AAD04346.1.
AF155809 mRNA. Translation: AAG29582.1.
AF155810 mRNA. Translation: AAG29583.1.
AF155811 mRNA. Translation: AAG29584.1.
AY358099 mRNA. Translation: AAQ88466.1.
AL035423 Genomic DNA. Translation: CAI42440.1.
AL035423 Genomic DNA. Translation: CAI42441.1.
AL035423 Genomic DNA. Translation: CAB41251.1.
CH471107 Genomic DNA. Translation: EAX11804.1.
BC119666 mRNA. Translation: AAI19667.1.
BC119667 mRNA. Translation: AAI19668.1.
CCDSiCCDS14623.1. [O95258-1]
CCDS14624.1. [O95258-2]
CCDS76020.1. [O95258-3]
RefSeqiNP_001269124.1. NM_001282195.1. [O95258-1]
NP_001269125.1. NM_001282196.1. [O95258-2]
NP_001269126.1. NM_001282197.1. [O95258-3]
NP_001269127.1. NM_001282198.1.
UniGeneiHs.194686.

Genome annotation databases

EnsembliENST00000218197; ENSP00000218197; ENSG00000102078. [O95258-1]
ENST00000339231; ENSP00000342797; ENSG00000102078. [O95258-3]
ENST00000361980; ENSP00000354455; ENSG00000102078. [O95258-2]
ENST00000545805; ENSP00000444642; ENSG00000102078. [O95258-1]
ENST00000612248; ENSP00000477981; ENSG00000102078. [O95258-3]
GeneIDi9016.
KEGGihsa:9016.
UCSCiuc004evp.1. human. [O95258-1]
uc004evq.1. human. [O95258-2]
uc004evr.1. human. [O95258-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF078544 mRNA. Translation: AAD04346.1 .
AF155809 mRNA. Translation: AAG29582.1 .
AF155810 mRNA. Translation: AAG29583.1 .
AF155811 mRNA. Translation: AAG29584.1 .
AY358099 mRNA. Translation: AAQ88466.1 .
AL035423 Genomic DNA. Translation: CAI42440.1 .
AL035423 Genomic DNA. Translation: CAI42441.1 .
AL035423 Genomic DNA. Translation: CAB41251.1 .
CH471107 Genomic DNA. Translation: EAX11804.1 .
BC119666 mRNA. Translation: AAI19667.1 .
BC119667 mRNA. Translation: AAI19668.1 .
CCDSi CCDS14623.1. [O95258-1 ]
CCDS14624.1. [O95258-2 ]
CCDS76020.1. [O95258-3 ]
RefSeqi NP_001269124.1. NM_001282195.1. [O95258-1 ]
NP_001269125.1. NM_001282196.1. [O95258-2 ]
NP_001269126.1. NM_001282197.1. [O95258-3 ]
NP_001269127.1. NM_001282198.1.
UniGenei Hs.194686.

3D structure databases

ProteinModelPortali O95258.
SMRi O95258. Positions 44-322.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114485. 2 interactions.
STRINGi 9606.ENSP00000218197.

Protein family/group databases

TCDBi 2.A.29.24.1. the mitochondrial carrier (mc) family.

PTM databases

PhosphoSitei O95258.

Proteomic databases

MaxQBi O95258.
PaxDbi O95258.
PRIDEi O95258.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000218197 ; ENSP00000218197 ; ENSG00000102078 . [O95258-1 ]
ENST00000339231 ; ENSP00000342797 ; ENSG00000102078 . [O95258-3 ]
ENST00000361980 ; ENSP00000354455 ; ENSG00000102078 . [O95258-2 ]
ENST00000545805 ; ENSP00000444642 ; ENSG00000102078 . [O95258-1 ]
ENST00000612248 ; ENSP00000477981 ; ENSG00000102078 . [O95258-3 ]
GeneIDi 9016.
KEGGi hsa:9016.
UCSCi uc004evp.1. human. [O95258-1 ]
uc004evq.1. human. [O95258-2 ]
uc004evr.1. human. [O95258-3 ]

Organism-specific databases

CTDi 9016.
GeneCardsi GC0XP129473.
HGNCi HGNC:10984. SLC25A14.
MIMi 300242. gene.
neXtProti NX_O95258.
PharmGKBi PA35860.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG240642.
GeneTreei ENSGT00760000119170.
HOGENOMi HOG000165140.
HOVERGENi HBG009528.
InParanoidi O95258.
KOi K15106.
OMAi WRCLCSK.
PhylomeDBi O95258.
TreeFami TF323211.

Miscellaneous databases

GeneWikii SLC25A14.
GenomeRNAii 9016.
NextBioi 33781.
PROi O95258.
SOURCEi Search...

Gene expression databases

Bgeei O95258.
CleanExi HS_SLC25A14.
ExpressionAtlasi O95258. baseline and differential.
Genevestigatori O95258.

Family and domain databases

Gene3Di 1.50.40.10. 1 hit.
InterProi IPR002030. Mit_uncoupling.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view ]
Pfami PF00153. Mito_carr. 3 hits.
[Graphical view ]
PRINTSi PR00784. MTUNCOUPLING.
SUPFAMi SSF103506. SSF103506. 1 hit.
PROSITEi PS50920. SOLCAR. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "BMCP1, a novel mitochondrial carrier with high expression in the central nervous system of humans and rodents, and respiration uncoupling activity in recombinant yeast."
    Sanchis D., Fleury C., Chomiki N., Goubern M., Huang Q., Neverova M., Gregoire F., Easlick J., Raimbault S., Levi-Meyrueis C., Miroux B., Collins S., Seldin M., Richard D., Warden C., Bouillaud F., Ricquier D.
    J. Biol. Chem. 273:34611-34615(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Characterization of novel UCP5/BMCP1 isoforms and differential regulation of UCP4 and UCP5 expression through dietary or temperature manipulation."
    Yu X.X., Mao W., Zhong A., Schow P., Brush J., Sherwood S.W., Adams S.H., Pan G.
    FASEB J. 14:1611-1618(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

Entry informationi

Entry nameiUCP5_HUMAN
AccessioniPrimary (citable) accession number: O95258
Secondary accession number(s): D3DTG2
, Q0VDH7, Q9HC60, Q9HC61
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: October 29, 2014
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3