O95258 (UCP5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Brain mitochondrial carrier protein 1 Short name=BMCP-1 Alternative name(s): Mitochondrial uncoupling protein 5 Short name=UCP 5 Solute carrier family 25 member 14 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 325 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Participates in the mitochondrial proton leak measured in brain mitochondria. |
| Subcellular location | Mitochondrion inner membrane; Multi-pass membrane protein By similarity. |
| Tissue specificity | Mainly expressed in brain. Some expression in testis and pituitary. Ref.2 |
| Sequence similarities | Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification] Contains 3 Solcar repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Membrane Mitochondrion Mitochondrion inner membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | aerobic respiration Traceable author statement Ref.1. Source: ProtInc mitochondrial transportInferred from electronic annotation. Source: InterPro transportTraceable author statement Ref.1. Source: ProtInc |
| Cellular_component | integral to plasma membrane Traceable author statement Ref.1. Source: ProtInc mitochondrial inner membraneInferred from electronic annotation. Source: UniProtKB-SubCell mitochondrionTraceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O95258-1) Also known as: UCP5L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O95258-2) Also known as: UCP5S; The sequence of this isoform differs from the canonical sequence as follows: 23-25: Missing. | ||||||
| Isoform 3 (identifier: O95258-3) Also known as: UCP5SI; The sequence of this isoform differs from the canonical sequence as follows: 23-25: Missing. 198-198: R → RCLCSKAVTGCVLWLMPVIPALWEANAGGSLE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 325 | 325 | Brain mitochondrial carrier protein 1 | PRO_0000090677 | |||||
Regions | |||||||||
| Transmembrane | 38 – 54 | 17 | Helical; Name=1; Potential | ||||||
| Transmembrane | 112 – 128 | 17 | Helical; Name=2; Potential | ||||||
| Transmembrane | 141 – 161 | 21 | Helical; Name=3; Potential | ||||||
| Transmembrane | 199 – 215 | 17 | Helical; Name=4; Potential | ||||||
| Transmembrane | 240 – 256 | 17 | Helical; Name=5; Potential | ||||||
| Transmembrane | 298 – 315 | 18 | Helical; Name=6; Potential | ||||||
| Repeat | 42 – 131 | 90 | Solcar 1 | ||||||
| Repeat | 139 – 224 | 86 | Solcar 2 | ||||||
| Repeat | 233 – 323 | 91 | Solcar 3 | ||||||
Natural variations | |||||||||
| Alternative sequence | 23 – 25 | 3 | Missing in isoform 2 and isoform 3. | VSP_003272 | |||||
| Alternative sequence | 198 | 1 | R → RCLCSKAVTGCVLWLMPVIP ALWEANAGGSLE in isoform 3. | VSP_003273 | |||||
| Natural variant | 55 | 1 | E → A. Corresponds to variant rs2143598 [ dbSNP | Ensembl ]. | VAR_050138 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "BMCP1, a novel mitochondrial carrier with high expression in the central nervous system of humans and rodents, and respiration uncoupling activity in recombinant yeast." Sanchis D., Fleury C., Chomiki N., Goubern M., Huang Q., Neverova M., Gregoire F., Easlick J., Raimbault S., Levi-Meyrueis C., Miroux B., Collins S., Seldin M., Richard D., Warden C., Bouillaud F., Ricquier D. J. Biol. Chem. 273:34611-34615(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Characterization of novel UCP5/BMCP1 isoforms and differential regulation of UCP4 and UCP5 expression through dietary or temperature manipulation." Yu X.X., Mao W., Zhong A., Schow P., Brush J., Sherwood S.W., Adams S.H., Pan G. FASEB J. 14:1611-1618(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, TISSUE SPECIFICITY. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF078544 mRNA. Translation: AAD04346.1. AF155809 mRNA. Translation: AAG29582.1. AF155810 mRNA. Translation: AAG29583.1. AF155811 mRNA. Translation: AAG29584.1. AY358099 mRNA. Translation: AAQ88466.1. AL035423 Genomic DNA. Translation: CAI42440.1. AL035423 Genomic DNA. Translation: CAI42441.1. AL035423 Genomic DNA. Translation: CAB41251.1. CH471107 Genomic DNA. Translation: EAX11804.1. BC119666 mRNA. Translation: AAI19667.1. BC119667 mRNA. Translation: AAI19668.1. |
| IPI | IPI00010162. IPI00029460. IPI00221084. |
| RefSeq | NP_003942.1. NM_003951.2. NP_073721.1. NM_022810.1. |
| UniGene | Hs.194686. |
3D structure databases | |
| ProteinModelPortal | O95258. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000218197. |
Protein family/group databases | |
| TCDB | 2.A.29.24.1. mitochondrial carrier (MC) family. |
PTM databases | |
| PhosphoSite | O95258. |
Proteomic databases | |
| PaxDb | O95258. |
| PRIDE | O95258. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000218197; ENSP00000218197; ENSG00000102078. ENST00000339231; ENSP00000342797; ENSG00000102078. ENST00000361980; ENSP00000354455; ENSG00000102078. |
| GeneID | 9016. |
| KEGG | hsa:9016. |
| UCSC | uc004evp.1. human. uc004evq.1. human. uc004evr.1. human. |
Organism-specific databases | |
| CTD | 9016. |
| GeneCards | GC0XP129473. |
| HGNC | HGNC:10984. SLC25A14. |
| MIM | 300242. gene. |
| neXtProt | NX_O95258. |
| PharmGKB | PA35860. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG240642. |
| HOGENOM | HOG000165140. |
| HOVERGEN | HBG009528. |
| KO | K15106. |
| OMA | WRCLCSK. |
| OrthoDB | EOG4V9TR9. |
Gene expression databases | |
| ArrayExpress | O95258. |
| Bgee | O95258. |
| CleanEx | HS_SLC25A14. |
| Genevestigator | O95258. |
| GermOnline | ENSG00000102078. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.50.40.10. 1 hit. |
| InterPro | IPR002030. Mit_uncoupling. IPR018108. Mitochondrial_sb/sol_carrier. IPR023395. Mt_carrier_dom. [Graphical view] |
| Pfam | PF00153. Mito_carr. 3 hits. [Graphical view] |
| PRINTS | PR00784. MTUNCOUPLING. |
| SUPFAM | SSF103506. Mitoch_carrier. 1 hit. |
| PROSITE | PS50920. SOLCAR. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 9016. |
| NextBio | 33781. |
| SOURCE | Search... |
Entry information
| Entry name | UCP5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95258 Secondary accession number(s): D3DTG2 Q9HC61 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
