Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95258

- UCP5_HUMAN

UniProt

O95258 - UCP5_HUMAN

Protein

Brain mitochondrial carrier protein 1

Gene

SLC25A14

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 128 (01 Oct 2014)
      Sequence version 1 (01 May 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Participates in the mitochondrial proton leak measured in brain mitochondria.

    GO - Biological processi

    1. aerobic respiration Source: ProtInc
    2. mitochondrial transport Source: InterPro
    3. transport Source: ProtInc

    Keywords - Biological processi

    Transport

    Protein family/group databases

    TCDBi2.A.29.24.1. the mitochondrial carrier (mc) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Brain mitochondrial carrier protein 1
    Short name:
    BMCP-1
    Alternative name(s):
    Mitochondrial uncoupling protein 5
    Short name:
    UCP 5
    Solute carrier family 25 member 14
    Gene namesi
    Name:SLC25A14
    Synonyms:BMCP1, UCP5
    ORF Names:UNQ791/PRO1682
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:10984. SLC25A14.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. mitochondrial inner membrane Source: UniProtKB-SubCell
    3. mitochondrion Source: ProtInc

    Keywords - Cellular componenti

    Membrane, Mitochondrion, Mitochondrion inner membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA35860.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 325325Brain mitochondrial carrier protein 1PRO_0000090677Add
    BLAST

    Proteomic databases

    MaxQBiO95258.
    PaxDbiO95258.
    PRIDEiO95258.

    PTM databases

    PhosphoSiteiO95258.

    Expressioni

    Tissue specificityi

    Mainly expressed in brain. Some expression in testis and pituitary.1 Publication

    Gene expression databases

    ArrayExpressiO95258.
    BgeeiO95258.
    CleanExiHS_SLC25A14.
    GenevestigatoriO95258.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000218197.

    Structurei

    3D structure databases

    ProteinModelPortaliO95258.
    SMRiO95258. Positions 44-322.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei38 – 5417Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei112 – 12817Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei141 – 16121Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei199 – 21517Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei240 – 25617Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei298 – 31518Helical; Name=6Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati42 – 13190Solcar 1Add
    BLAST
    Repeati139 – 22486Solcar 2Add
    BLAST
    Repeati233 – 32391Solcar 3Add
    BLAST

    Sequence similaritiesi

    Contains 3 Solcar repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG240642.
    HOGENOMiHOG000165140.
    HOVERGENiHBG009528.
    KOiK15106.
    OMAiWRCLCSK.
    PhylomeDBiO95258.
    TreeFamiTF323211.

    Family and domain databases

    Gene3Di1.50.40.10. 1 hit.
    InterProiIPR002030. Mit_uncoupling.
    IPR018108. Mitochondrial_sb/sol_carrier.
    IPR023395. Mt_carrier_dom.
    [Graphical view]
    PfamiPF00153. Mito_carr. 3 hits.
    [Graphical view]
    PRINTSiPR00784. MTUNCOUPLING.
    SUPFAMiSSF103506. SSF103506. 1 hit.
    PROSITEiPS50920. SOLCAR. 3 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O95258-1) [UniParc]FASTAAdd to Basket

    Also known as: UCP5L

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGIFPGIILI FLRVKFATAA VIVSGHQKST TVSHEMSGLN WKPFVYGGLA    50
    SIVAEFGTFP VDLTKTRLQV QGQSIDARFK EIKYRGMFHA LFRICKEEGV 100
    LALYSGIAPA LLRQASYGTI KIGIYQSLKR LFVERLEDET LLINMICGVV 150
    SGVISSTIAN PTDVLKIRMQ AQGSLFQGSM IGSFIDIYQQ EGTRGLWRGV 200
    VPTAQRAAIV VGVELPVYDI TKKHLILSGM MGDTILTHFV SSFTCGLAGA 250
    LASNPVDVVR TRMMNQRAIV GHVDLYKGTV DGILKMWKHE GFFALYKGFW 300
    PNWLRLGPWN IIFFITYEQL KRLQI 325
    Length:325
    Mass (Da):36,202
    Last modified:May 1, 1999 - v1
    Checksum:i0447E8E3B5374982
    GO
    Isoform 2 (identifier: O95258-2) [UniParc]FASTAAdd to Basket

    Also known as: UCP5S

    The sequence of this isoform differs from the canonical sequence as follows:
         23-25: Missing.

    Show »
    Length:322
    Mass (Da):35,958
    Checksum:iF3C186B06ADC0F6A
    GO
    Isoform 3 (identifier: O95258-3) [UniParc]FASTAAdd to Basket

    Also known as: UCP5SI

    The sequence of this isoform differs from the canonical sequence as follows:
         23-25: Missing.
         198-198: R → RCLCSKAVTGCVLWLMPVIPALWEANAGGSLE

    Show »
    Length:353
    Mass (Da):39,173
    Checksum:i8A66113E6FAE9C7B
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti55 – 551E → A.
    Corresponds to variant rs2143598 [ dbSNP | Ensembl ].
    VAR_050138

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei23 – 253Missing in isoform 2 and isoform 3. CuratedVSP_003272
    Alternative sequencei198 – 1981R → RCLCSKAVTGCVLWLMPVIP ALWEANAGGSLE in isoform 3. CuratedVSP_003273

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF078544 mRNA. Translation: AAD04346.1.
    AF155809 mRNA. Translation: AAG29582.1.
    AF155810 mRNA. Translation: AAG29583.1.
    AF155811 mRNA. Translation: AAG29584.1.
    AY358099 mRNA. Translation: AAQ88466.1.
    AL035423 Genomic DNA. Translation: CAI42440.1.
    AL035423 Genomic DNA. Translation: CAI42441.1.
    AL035423 Genomic DNA. Translation: CAB41251.1.
    CH471107 Genomic DNA. Translation: EAX11804.1.
    BC119666 mRNA. Translation: AAI19667.1.
    BC119667 mRNA. Translation: AAI19668.1.
    CCDSiCCDS14623.1. [O95258-1]
    CCDS14624.1. [O95258-2]
    RefSeqiNP_001269124.1. NM_001282195.1. [O95258-1]
    NP_001269125.1. NM_001282196.1. [O95258-2]
    NP_001269126.1. NM_001282197.1. [O95258-3]
    NP_001269127.1. NM_001282198.1.
    UniGeneiHs.194686.

    Genome annotation databases

    EnsembliENST00000218197; ENSP00000218197; ENSG00000102078. [O95258-1]
    ENST00000339231; ENSP00000342797; ENSG00000102078. [O95258-3]
    ENST00000361980; ENSP00000354455; ENSG00000102078. [O95258-2]
    GeneIDi9016.
    KEGGihsa:9016.
    UCSCiuc004evp.1. human. [O95258-1]
    uc004evq.1. human. [O95258-2]
    uc004evr.1. human. [O95258-3]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF078544 mRNA. Translation: AAD04346.1 .
    AF155809 mRNA. Translation: AAG29582.1 .
    AF155810 mRNA. Translation: AAG29583.1 .
    AF155811 mRNA. Translation: AAG29584.1 .
    AY358099 mRNA. Translation: AAQ88466.1 .
    AL035423 Genomic DNA. Translation: CAI42440.1 .
    AL035423 Genomic DNA. Translation: CAI42441.1 .
    AL035423 Genomic DNA. Translation: CAB41251.1 .
    CH471107 Genomic DNA. Translation: EAX11804.1 .
    BC119666 mRNA. Translation: AAI19667.1 .
    BC119667 mRNA. Translation: AAI19668.1 .
    CCDSi CCDS14623.1. [O95258-1 ]
    CCDS14624.1. [O95258-2 ]
    RefSeqi NP_001269124.1. NM_001282195.1. [O95258-1 ]
    NP_001269125.1. NM_001282196.1. [O95258-2 ]
    NP_001269126.1. NM_001282197.1. [O95258-3 ]
    NP_001269127.1. NM_001282198.1.
    UniGenei Hs.194686.

    3D structure databases

    ProteinModelPortali O95258.
    SMRi O95258. Positions 44-322.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000218197.

    Protein family/group databases

    TCDBi 2.A.29.24.1. the mitochondrial carrier (mc) family.

    PTM databases

    PhosphoSitei O95258.

    Proteomic databases

    MaxQBi O95258.
    PaxDbi O95258.
    PRIDEi O95258.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000218197 ; ENSP00000218197 ; ENSG00000102078 . [O95258-1 ]
    ENST00000339231 ; ENSP00000342797 ; ENSG00000102078 . [O95258-3 ]
    ENST00000361980 ; ENSP00000354455 ; ENSG00000102078 . [O95258-2 ]
    GeneIDi 9016.
    KEGGi hsa:9016.
    UCSCi uc004evp.1. human. [O95258-1 ]
    uc004evq.1. human. [O95258-2 ]
    uc004evr.1. human. [O95258-3 ]

    Organism-specific databases

    CTDi 9016.
    GeneCardsi GC0XP129473.
    HGNCi HGNC:10984. SLC25A14.
    MIMi 300242. gene.
    neXtProti NX_O95258.
    PharmGKBi PA35860.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG240642.
    HOGENOMi HOG000165140.
    HOVERGENi HBG009528.
    KOi K15106.
    OMAi WRCLCSK.
    PhylomeDBi O95258.
    TreeFami TF323211.

    Miscellaneous databases

    GeneWikii SLC25A14.
    GenomeRNAii 9016.
    NextBioi 33781.
    PROi O95258.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95258.
    Bgeei O95258.
    CleanExi HS_SLC25A14.
    Genevestigatori O95258.

    Family and domain databases

    Gene3Di 1.50.40.10. 1 hit.
    InterProi IPR002030. Mit_uncoupling.
    IPR018108. Mitochondrial_sb/sol_carrier.
    IPR023395. Mt_carrier_dom.
    [Graphical view ]
    Pfami PF00153. Mito_carr. 3 hits.
    [Graphical view ]
    PRINTSi PR00784. MTUNCOUPLING.
    SUPFAMi SSF103506. SSF103506. 1 hit.
    PROSITEi PS50920. SOLCAR. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "BMCP1, a novel mitochondrial carrier with high expression in the central nervous system of humans and rodents, and respiration uncoupling activity in recombinant yeast."
      Sanchis D., Fleury C., Chomiki N., Goubern M., Huang Q., Neverova M., Gregoire F., Easlick J., Raimbault S., Levi-Meyrueis C., Miroux B., Collins S., Seldin M., Richard D., Warden C., Bouillaud F., Ricquier D.
      J. Biol. Chem. 273:34611-34615(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Characterization of novel UCP5/BMCP1 isoforms and differential regulation of UCP4 and UCP5 expression through dietary or temperature manipulation."
      Yu X.X., Mao W., Zhong A., Schow P., Brush J., Sherwood S.W., Adams S.H., Pan G.
      FASEB J. 14:1611-1618(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

    Entry informationi

    Entry nameiUCP5_HUMAN
    AccessioniPrimary (citable) accession number: O95258
    Secondary accession number(s): D3DTG2
    , Q0VDH7, Q9HC60, Q9HC61
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 128 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3