Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Reticulon-3

Gene

RTN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis. Induces the formation of endoplasmic reticulum tubules (PubMed:25612671).5 Publications

GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • chemical synaptic transmission Source: Reactome
  • endoplasmic reticulum tubular network assembly Source: UniProtKB
  • endoplasmic reticulum tubular network organization Source: UniProtKB
  • vesicle-mediated transport Source: UniProtKB-KW
  • viral process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Apoptosis, ER-Golgi transport, Host-virus interaction, Stress response, Transport

Enzyme and pathway databases

BioCyciZFISH:ENSG00000133318-MONOMER.
ReactomeiR-HSA-8849932. SALM protein interactions at the synapses.

Names & Taxonomyi

Protein namesi
Recommended name:
Reticulon-3
Alternative name(s):
Homolog of ASY protein
Short name:
HAP
Neuroendocrine-specific protein-like 2
Short name:
NSP-like protein 2
Neuroendocrine-specific protein-like II
Short name:
NSP-like protein II
Short name:
NSPLII
Gene namesi
Name:RTN3
Synonyms:ASYIP, NSPL2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:10469. RTN3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini2 – 863CytoplasmicSequence analysisAdd BLAST862
Intramembranei864 – 887HelicalSequence analysisAdd BLAST24
Topological domaini888 – 947CytoplasmicSequence analysisAdd BLAST60
Intramembranei948 – 968HelicalSequence analysisAdd BLAST21
Topological domaini969 – 972CytoplasmicSequence analysis4
Intramembranei973 – 993HelicalSequence analysisAdd BLAST21
Topological domaini994 – 1032CytoplasmicSequence analysisAdd BLAST39

GO - Cellular componenti

  • endomembrane system Source: GO_Central
  • endoplasmic reticulum Source: HPA
  • endoplasmic reticulum membrane Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • extracellular space Source: ProtInc
  • Golgi membrane Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi10313.
OpenTargetsiENSG00000133318.
PharmGKBiPA34882.

Polymorphism and mutation databases

BioMutaiRTN3.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001681632 – 1032Reticulon-3Add BLAST1031

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei30PhosphoserineCombined sources1
Modified residuei229PhosphoserineCombined sources1
Modified residuei243PhosphoserineBy similarity1
Modified residuei246PhosphoserineCombined sources1
Modified residuei283PhosphoserineBy similarity1
Modified residuei316PhosphoserineCombined sources1
Modified residuei453PhosphoserineCombined sources1
Modified residuei649PhosphoserineCombined sources1
Modified residuei650PhosphoserineCombined sources1
Modified residuei735PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO95197.
MaxQBiO95197.
PaxDbiO95197.
PeptideAtlasiO95197.
PRIDEiO95197.
TopDownProteomicsiO95197-2. [O95197-2]
O95197-3. [O95197-3]
O95197-4. [O95197-4]

PTM databases

iPTMnetiO95197.
PhosphoSitePlusiO95197.
SwissPalmiO95197.

Expressioni

Tissue specificityi

Isoform 3 is widely expressed, with highest levels in brain, where it is enriched in neuronal cell bodies from gray matter (at protein level). Three times more abundant in macula than in peripheral retina. Isoform 1 is expressed at high levels in brain and at low levels in skeletal muscle. Isoform 2 is only found in melanoma.5 Publications

Inductioni

By endoplasmic reticulum stress (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000133318.
ExpressionAtlasiO95197. baseline and differential.
GenevisibleiO95197. HS.

Organism-specific databases

HPAiHPA015649.
HPA015650.

Interactioni

Subunit structurei

Homodimer. Interacts with ATL1 (By similarity). Interacts with RTN4. Isoform 3 interacts with BACE1, BACE2, BCL2 and FADD. Interacts with Coxsackievirus A16, enterovirus 71 and poliovirus P2C proteins. Interacts with ATL2. Interacts with TMEM33 (By similarity). Interacts with ZFYVE27 and with KIF5A in a ZFYVE27-dependent manner (PubMed:21976701).By similarity9 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CDIPTO147353EBI-740467,EBI-358858
PPP2R3CQ969Q63EBI-740467,EBI-2561661
PTPN9P433784EBI-740467,EBI-742898
PTPN9Q6IQ433EBI-740467,EBI-10250413
SNX1Q135963EBI-740467,EBI-2822329
TERF1P542742EBI-740467,EBI-710997

Protein-protein interaction databases

BioGridi115598. 23 interactors.
IntActiO95197. 28 interactors.
MINTiMINT-5000642.
STRINGi9606.ENSP00000344106.

Structurei

3D structure databases

ProteinModelPortaliO95197.
SMRiO95197.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini844 – 1032ReticulonPROSITE-ProRule annotationAdd BLAST189

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni987 – 1032Interaction with FADD1 PublicationAdd BLAST46
Regioni1000 – 1002Interaction with BACE13

Sequence similaritiesi

Contains 1 reticulon domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1792. Eukaryota.
ENOG410XPKH. LUCA.
GeneTreeiENSGT00390000009934.
HOVERGENiHBG093922.
InParanoidiO95197.
KOiK20723.
OMAiPPIYEKN.
OrthoDBiEOG091G0TIO.
PhylomeDBiO95197.
TreeFamiTF105431.

Family and domain databases

InterProiIPR003388. Reticulon.
[Graphical view]
PfamiPF02453. Reticulon. 1 hit.
[Graphical view]
PROSITEiPS50845. RETICULON. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95197-1) [UniParc]FASTAAdd to basket
Also known as: A1, A4b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEPSAATQS HSISSSSFGA EPSAPGGGGS PGACPALGTK SCSSSCADSF
60 70 80 90 100
VSSSSSQPVS LFSTSQEGLS SLCSDEPSSE IMTSSFLSSS EIHNTGLTIL
110 120 130 140 150
HGEKSHVLGS QPILAKEGKD HLDLLDMKKM EKPQGTSNNV SDSSVSLAAG
160 170 180 190 200
VHCDRPSIPA SFPEHPAFLS KKIGQVEEQI DKETKNPNGV SSREAKTALD
210 220 230 240 250
ADDRFTLLTA QKPPTEYSKV EGIYTYSLSP SKVSGDDVIE KDSPESPFEV
260 270 280 290 300
IIDKAAFDKE FKDSYKESTD DFGSWSVHTD KESSEDISET NDKLFPLRNK
310 320 330 340 350
EAGRYPMSAL LSRQFSHTNA ALEEVSRCVN DMHNFTNEIL TWDLVPQVKQ
360 370 380 390 400
QTDKSSDCIT KTTGLDMSEY NSEIPVVNLK TSTHQKTPVC SIDGSTPITK
410 420 430 440 450
STGDWAEASL QQENAITGKP VPDSLNSTKE FSIKGVQGNM QKQDDTLAEL
460 470 480 490 500
PGSPPEKCDS LGSGVATVKV VLPDDHLKDE MDWQSSALGE ITEADSSGES
510 520 530 540 550
DDTVIEDITA DTSFENNKIQ AEKPVSIPSA VVKTGEREIK EIPSCEREEK
560 570 580 590 600
TSKNFEELVS DSELHQDQPD ILGRSPASEA ACSKVPDTNV SLEDVSEVAP
610 620 630 640 650
EKPITTENPK LPSTVSPNVF NETEFSLNVT TSAYLESLHG KNVKHIDDSS
660 670 680 690 700
PEDLIAAFTE TRDKGIVDSE RNAFKAISEK MTDFKTTPPV EVLHENESGG
710 720 730 740 750
SEIKDIGSKY SEQSKETNGS EPLGVFPTQG TPVASLDLEQ EQLTIKALKE
760 770 780 790 800
LGERQVEKST SAQRDAELPS EEVLKQTFTF APESWPQRSY DILERNVKNG
810 820 830 840 850
SDLGISQKPI TIRETTRVDA VSSLSKTELV KKHVLARLLT DFSVHDLIFW
860 870 880 890 900
RDVKKTGFVF GTTLIMLLSL AAFSVISVVS YLILALLSVT ISFRIYKSVI
910 920 930 940 950
QAVQKSEEGH PFKAYLDVDI TLSSEAFHNY MNAAMVHINR ALKLIIRLFL
960 970 980 990 1000
VEDLVDSLKL AVFMWLMTYV GAVFNGITLL ILAELLIFSV PIVYEKYKTQ
1010 1020 1030
IDHYVGIARD QTKSIVEKIQ AKLPGIAKKK AE
Length:1,032
Mass (Da):112,611
Last modified:March 20, 2007 - v2
Checksum:i26B372B82BFC6361
GO
Isoform 2 (identifier: O95197-2) [UniParc]FASTAAdd to basket
Also known as: A2, A3b

The sequence of this isoform differs from the canonical sequence as follows:
     48-66: Missing.

Show »
Length:1,013
Mass (Da):110,652
Checksum:i26EBCFC7BF6351FC
GO
Isoform 3 (identifier: O95197-3) [UniParc]FASTAAdd to basket
Also known as: B1, A1

The sequence of this isoform differs from the canonical sequence as follows:
     48-66: Missing.
     67-843: Missing.

Show »
Length:236
Mass (Da):25,609
Checksum:iDDC6A4544ABCDFB7
GO
Isoform 4 (identifier: O95197-4) [UniParc]FASTAAdd to basket
Also known as: B2, A2

The sequence of this isoform differs from the canonical sequence as follows:
     67-843: Missing.

Show »
Length:255
Mass (Da):27,568
Checksum:iA1EB93C4659AD832
GO
Isoform 5 (identifier: O95197-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-66: Missing.
     67-843: Missing.
     999-1032: TQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE → DPSKTPWNRQKKGRISTWKPEMQQLLKHHLIVITSLLVL

Note: No experimental confirmation available.
Show »
Length:241
Mass (Da):26,452
Checksum:i12919C71F2208160
GO
Isoform 6 (identifier: O95197-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-843: Missing.
     914-1032: AYLDVDITLS...LPGIAKKKAE → PRLITMLASP...PQYQAQKLMD

Show »
Length:214
Mass (Da):23,489
Checksum:iD066FBEA9D48E49C
GO
Isoform 7 (identifier: O95197-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-159: Missing.

Note: Gene prediction based on EST data.
Show »
Length:920
Mass (Da):100,824
Checksum:i5C36B72E4243492C
GO

Sequence cautioni

The sequence BAD93008 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti871A → V in BAD93008 (PubMed:15946766).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0311646A → E.1 PublicationCorresponds to variant rs11551944dbSNPEnsembl.1
Natural variantiVAR_057713501D → H.Corresponds to variant rs7936660dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04531948 – 843Missing in isoform 6. 1 PublicationAdd BLAST796
Alternative sequenceiVSP_04700848 – 159Missing in isoform 7. CuratedAdd BLAST112
Alternative sequenceiVSP_02375948 – 66Missing in isoform 2, isoform 3 and isoform 5. 7 PublicationsAdd BLAST19
Alternative sequenceiVSP_02376067 – 843Missing in isoform 3, isoform 4 and isoform 5. 7 PublicationsAdd BLAST777
Alternative sequenceiVSP_045320914 – 1032AYLDV…KKKAE → PRLITMLASPEIRPSQLLKR SKQNSLESPKKRQNKYMETR NATVTKTPFNSYNVVTCTMK ENTQCQLEPAFQAFFLIWCF LPSFPFNPQYQAQKLMD in isoform 6. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_023761999 – 1032TQIDH…KKKAE → DPSKTPWNRQKKGRISTWKP EMQQLLKHHLIVITSLLVL in isoform 5. CuratedAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059524 mRNA. Translation: AAC99319.1.
AF059529
, AF059525, AF059526, AF059527, AF059528 Genomic DNA. Translation: AAD20951.1.
AF119297 mRNA. Translation: AAD26810.1.
AY427821 mRNA. Translation: AAR02474.1.
AY750848 mRNA. Translation: AAU81930.1.
AP000753 Genomic DNA. No translation available.
AP006289 Genomic DNA. No translation available.
AK297529 mRNA. Translation: BAH12606.1.
AB209771 mRNA. Translation: BAD93008.1. Different initiation.
AK075412 mRNA. Translation: BAG52134.1.
AK222898 mRNA. Translation: BAD96618.1.
AK295361 mRNA. Translation: BAH12044.1.
CH471076 Genomic DNA. Translation: EAW74170.1.
BC000634 mRNA. Translation: AAH00634.1.
BC010556 mRNA. Translation: AAH10556.1.
BC011394 mRNA. Translation: AAH11394.1.
BC022993 mRNA. Translation: AAH22993.1.
BC100822 mRNA. Translation: AAI00823.1.
BC100823 mRNA. Translation: AAI00824.1.
BC105981 mRNA. Translation: AAI05982.1.
BC105982 mRNA. Translation: AAI05983.1.
BC118628 mRNA. Translation: AAI18629.1.
BC118550 mRNA. Translation: AAI18551.1.
BK001685 mRNA. Translation: DAA01931.1.
BK001681 mRNA. Translation: DAA01941.1.
BK001684 mRNA. Translation: DAA01943.1.
CCDSiCCDS41664.1. [O95197-4]
CCDS58141.1. [O95197-1]
CCDS58142.1. [O95197-7]
CCDS58143.1. [O95197-6]
CCDS8048.1. [O95197-5]
CCDS8049.1. [O95197-3]
CCDS8050.1. [O95197-2]
RefSeqiNP_001252518.1. NM_001265589.1. [O95197-1]
NP_001252519.1. NM_001265590.1. [O95197-7]
NP_001252520.1. NM_001265591.1. [O95197-6]
NP_006045.1. NM_006054.3. [O95197-3]
NP_958831.1. NM_201428.2. [O95197-2]
NP_958832.1. NM_201429.2. [O95197-4]
NP_958833.1. NM_201430.2. [O95197-5]
UniGeneiHs.743229.

Genome annotation databases

EnsembliENST00000339997; ENSP00000344106; ENSG00000133318. [O95197-2]
ENST00000341307; ENSP00000340903; ENSG00000133318. [O95197-5]
ENST00000354497; ENSP00000346492; ENSG00000133318. [O95197-6]
ENST00000356000; ENSP00000348279; ENSG00000133318. [O95197-4]
ENST00000377819; ENSP00000367050; ENSG00000133318. [O95197-1]
ENST00000537981; ENSP00000440874; ENSG00000133318. [O95197-3]
ENST00000540798; ENSP00000442733; ENSG00000133318. [O95197-7]
GeneIDi10313.
KEGGihsa:10313.
UCSCiuc001nxm.3. human. [O95197-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059524 mRNA. Translation: AAC99319.1.
AF059529
, AF059525, AF059526, AF059527, AF059528 Genomic DNA. Translation: AAD20951.1.
AF119297 mRNA. Translation: AAD26810.1.
AY427821 mRNA. Translation: AAR02474.1.
AY750848 mRNA. Translation: AAU81930.1.
AP000753 Genomic DNA. No translation available.
AP006289 Genomic DNA. No translation available.
AK297529 mRNA. Translation: BAH12606.1.
AB209771 mRNA. Translation: BAD93008.1. Different initiation.
AK075412 mRNA. Translation: BAG52134.1.
AK222898 mRNA. Translation: BAD96618.1.
AK295361 mRNA. Translation: BAH12044.1.
CH471076 Genomic DNA. Translation: EAW74170.1.
BC000634 mRNA. Translation: AAH00634.1.
BC010556 mRNA. Translation: AAH10556.1.
BC011394 mRNA. Translation: AAH11394.1.
BC022993 mRNA. Translation: AAH22993.1.
BC100822 mRNA. Translation: AAI00823.1.
BC100823 mRNA. Translation: AAI00824.1.
BC105981 mRNA. Translation: AAI05982.1.
BC105982 mRNA. Translation: AAI05983.1.
BC118628 mRNA. Translation: AAI18629.1.
BC118550 mRNA. Translation: AAI18551.1.
BK001685 mRNA. Translation: DAA01931.1.
BK001681 mRNA. Translation: DAA01941.1.
BK001684 mRNA. Translation: DAA01943.1.
CCDSiCCDS41664.1. [O95197-4]
CCDS58141.1. [O95197-1]
CCDS58142.1. [O95197-7]
CCDS58143.1. [O95197-6]
CCDS8048.1. [O95197-5]
CCDS8049.1. [O95197-3]
CCDS8050.1. [O95197-2]
RefSeqiNP_001252518.1. NM_001265589.1. [O95197-1]
NP_001252519.1. NM_001265590.1. [O95197-7]
NP_001252520.1. NM_001265591.1. [O95197-6]
NP_006045.1. NM_006054.3. [O95197-3]
NP_958831.1. NM_201428.2. [O95197-2]
NP_958832.1. NM_201429.2. [O95197-4]
NP_958833.1. NM_201430.2. [O95197-5]
UniGeneiHs.743229.

3D structure databases

ProteinModelPortaliO95197.
SMRiO95197.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115598. 23 interactors.
IntActiO95197. 28 interactors.
MINTiMINT-5000642.
STRINGi9606.ENSP00000344106.

PTM databases

iPTMnetiO95197.
PhosphoSitePlusiO95197.
SwissPalmiO95197.

Polymorphism and mutation databases

BioMutaiRTN3.

Proteomic databases

EPDiO95197.
MaxQBiO95197.
PaxDbiO95197.
PeptideAtlasiO95197.
PRIDEiO95197.
TopDownProteomicsiO95197-2. [O95197-2]
O95197-3. [O95197-3]
O95197-4. [O95197-4]

Protocols and materials databases

DNASUi10313.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339997; ENSP00000344106; ENSG00000133318. [O95197-2]
ENST00000341307; ENSP00000340903; ENSG00000133318. [O95197-5]
ENST00000354497; ENSP00000346492; ENSG00000133318. [O95197-6]
ENST00000356000; ENSP00000348279; ENSG00000133318. [O95197-4]
ENST00000377819; ENSP00000367050; ENSG00000133318. [O95197-1]
ENST00000537981; ENSP00000440874; ENSG00000133318. [O95197-3]
ENST00000540798; ENSP00000442733; ENSG00000133318. [O95197-7]
GeneIDi10313.
KEGGihsa:10313.
UCSCiuc001nxm.3. human. [O95197-1]

Organism-specific databases

CTDi10313.
DisGeNETi10313.
GeneCardsiRTN3.
H-InvDBHIX0021346.
HGNCiHGNC:10469. RTN3.
HPAiHPA015649.
HPA015650.
MIMi604249. gene.
neXtProtiNX_O95197.
OpenTargetsiENSG00000133318.
PharmGKBiPA34882.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1792. Eukaryota.
ENOG410XPKH. LUCA.
GeneTreeiENSGT00390000009934.
HOVERGENiHBG093922.
InParanoidiO95197.
KOiK20723.
OMAiPPIYEKN.
OrthoDBiEOG091G0TIO.
PhylomeDBiO95197.
TreeFamiTF105431.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000133318-MONOMER.
ReactomeiR-HSA-8849932. SALM protein interactions at the synapses.

Miscellaneous databases

ChiTaRSiRTN3. human.
GeneWikiiRTN3.
GenomeRNAii10313.
PROiO95197.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000133318.
ExpressionAtlasiO95197. baseline and differential.
GenevisibleiO95197. HS.

Family and domain databases

InterProiIPR003388. Reticulon.
[Graphical view]
PfamiPF02453. Reticulon. 1 hit.
[Graphical view]
PROSITEiPS50845. RETICULON. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRTN3_HUMAN
AccessioniPrimary (citable) accession number: O95197
Secondary accession number(s): B3KQS2
, B7Z308, B7Z4M0, F5H774, Q147U9, Q496K2, Q53GN3, Q59EP0, Q5UEP2, Q6T930, Q7RTM7, Q7RTM8, Q7RTN3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: March 20, 2007
Last modified: November 30, 2016
This is version 153 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.