Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O95155

- UBE4B_HUMAN

UniProt

O95155 - UBE4B_HUMAN

Protein

Ubiquitin conjugation factor E4 B

Gene

UBE4B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 124 (01 Oct 2014)
      Sequence version 1 (01 May 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Binds to the ubiquitin moieties of preformed conjugates and catalyzes ubiquitin chain assembly in conjunction with E1, E2, and E3.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei109 – 1102Cleavage; by caspase-3 and caspase-7
    Sitei123 – 1242Cleavage; by caspase-6 and granzyme B

    GO - Molecular functioni

    1. enzyme binding Source: UniProtKB
    2. ubiquitin-ubiquitin ligase activity Source: InterPro

    GO - Biological processi

    1. granzyme-mediated apoptotic signaling pathway Source: UniProtKB
    2. proteasome-mediated ubiquitin-dependent protein catabolic process Source: MGI
    3. protein ubiquitination involved in ubiquitin-dependent protein catabolic process Source: UniProtKB
    4. response to UV Source: UniProtKB

    Keywords - Biological processi

    Ubl conjugation pathway

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ubiquitin conjugation factor E4 B
    Alternative name(s):
    Homozygously deleted in neuroblastoma 1
    Ubiquitin fusion degradation protein 2
    Gene namesi
    Name:UBE4B
    Synonyms:HDNB1, KIAA0684, UFD2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:12500. UBE4B.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. ubiquitin ligase complex Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi109 – 1091D → A: Abolishes cleavage by caspase-3 and caspase-7. 1 Publication
    Mutagenesisi121 – 1211D → A: Abolishes cleavage by caspase-6. No effect on cleavage by granzyme B. 1 Publication
    Mutagenesisi123 – 1231D → A: Abolishes cleavage by caspase-6 and granzyme B. 1 Publication

    Organism-specific databases

    PharmGKBiPA37148.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 13021302Ubiquitin conjugation factor E4 BPRO_0000194993Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine2 Publications
    Modified residuei31 – 311Phosphoserine2 Publications
    Modified residuei84 – 841Phosphoserine1 Publication
    Modified residuei88 – 881Phosphoserine2 Publications
    Modified residuei90 – 901Phosphoserine2 Publications
    Modified residuei101 – 1011Phosphoserine2 Publications
    Modified residuei103 – 1031Phosphoserine1 Publication
    Modified residuei803 – 8031Phosphoserine5 Publications
    Modified residuei1265 – 12651Phosphoserine1 Publication

    Post-translational modificationi

    Proteolytically cleaved by caspases during apoptosis. Cleaved efficiently at Asp-123 by caspase-6 and granzyme B. Cleaved with approximately 10-fold less efficiency at Asp-109 by caspase-3 and caspase-7.1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiO95155.
    PaxDbiO95155.
    PRIDEiO95155.

    PTM databases

    PhosphoSiteiO95155.

    Miscellaneous databases

    PMAP-CutDBO95155.

    Expressioni

    Tissue specificityi

    Highest expression in ovary, testis, heart and skeletal muscle. Expression is low in colon, thymus and peripheral blood leukocytes. Almost undetectable in lung and spleen.1 Publication

    Gene expression databases

    ArrayExpressiO95155.
    BgeeiO95155.
    CleanExiHS_UBE4B.
    GenevestigatoriO95155.

    Organism-specific databases

    HPAiHPA019219.

    Interactioni

    Subunit structurei

    Interacts with VCP.By similarity

    Protein-protein interaction databases

    BioGridi115566. 66 interactions.
    DIPiDIP-40309N.
    IntActiO95155. 6 interactions.
    MINTiMINT-2798575.
    STRINGi9606.ENSP00000343001.

    Structurei

    Secondary structure

    1
    1302
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi1230 – 12323
    Turni1235 – 12373
    Beta strandi1242 – 12465
    Turni1248 – 12503
    Beta strandi1252 – 12543
    Helixi1255 – 126410
    Turni1269 – 12713
    Helixi1277 – 12793
    Helixi1284 – 129815

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2KRENMR-A1208-1302[»]
    3L1XX-ray2.60A1208-1302[»]
    3L1ZX-ray3.17B1208-1302[»]
    ProteinModelPortaliO95155.
    SMRiO95155. Positions 1223-1300.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO95155.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1227 – 130074U-boxAdd
    BLAST

    Sequence similaritiesi

    Contains 1 U-box domain.Curated

    Phylogenomic databases

    eggNOGiCOG5113.
    HOGENOMiHOG000294109.
    HOVERGENiHBG058129.
    InParanoidiO95155.
    KOiK10597.
    OMAiTENMLEP.
    OrthoDBiEOG7TXKFT.
    PhylomeDBiO95155.
    TreeFamiTF300802.

    Family and domain databases

    Gene3Di3.30.40.10. 1 hit.
    InterProiIPR019474. Ub_conjug_fac_E4_core.
    IPR003613. Ubox_domain.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    PfamiPF04564. U-box. 1 hit.
    PF10408. Ufd2P_core. 1 hit.
    [Graphical view]
    SMARTiSM00504. Ubox. 1 hit.
    [Graphical view]
    PROSITEiPS51698. U_BOX. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O95155-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEELSADEIR RRRLARLAGG QTSQPTTPLT SPQRENPPGP PIAASAPGPS     50
    QSLGLNVHNM TPATSPIGAS GVAHRSQSSE GVSSLSSSPS NSLETQSQSL 100
    SRSQSMDIDG VSCEKSMSQV DVDSGIENME VDENDRREKR SLSDKEPSSG 150
    PEVSEEQALQ LVCKIFRVSW KDRDRDVIFL SSLSAQFKQN PKEVFSDFKD 200
    LIGQILMEVL MMSTQTRDEN PFASLTATSQ PIAAAARSPD RNLLLNTGSN 250
    PGTSPMFCSV ASFGASSLSS LYESSPAPTP SFWSSVPVMG PSLASPSRAA 300
    SQLAVPSTPL SPHSAASGTA AGSQPSSPRY RPYTVTHPWA SSGVSILSSS 350
    PSPPALASSP QAVPASSSRQ RPSSTGPPLP PASPSATSRR PSSLRISPSL 400
    GASGGASNWD SYSDHFTIET CKETDMLNYL IECFDRVGIE EKKAPKMCSQ 450
    PAVSQLLSNI RSQCISHTAL VLQGSLTQPR SLQQPSFLVP YMLCRNLPYG 500
    FIQELVRTTH QDEEVFKQIF IPILQGLALA AKECSLDSDY FKYPLMALGE 550
    LCETKFGKTH PVCNLVASLR LWLPKSLSPG CGRELQRLSY LGAFFSFSVF 600
    AEDDVKVVEK YFSGPAITLE NTRVVSQSLQ HYLELGRQEL FKILHSILLN 650
    GETREAALSY MAAVVNANMK KAQMQTDDRL VSTDGFMLNF LWVLQQLSTK 700
    IKLETVDPTY IFHPRCRITL PNDETRVNAT MEDVNDWLTE LYGDQPPFSE 750
    PKFPTECFFL TLHAHHLSIL PSCRRYIRRL RAIRELNRTV EDLKNNESQW 800
    KDSPLATRHR EMLKRCKTQL KKLVRCKACA DAGLLDESFL RRCLNFYGLL 850
    IQLLLRILDP AYPDITLPLN SDVPKVFAAL PEFYVEDVAE FLFFIVQYSP 900
    QALYEPCTQD IVMFLVVMLC NQNYIRNPYL VAKLVEVMFM TNPAVQPRTQ 950
    KFFEMIENHP LSTKLLVPSL MKFYTDVEHT GATSEFYDKF TIRYHISTIF 1000
    KSLWQNIAHH GTFMEEFNSG KQFVRYINML INDTTFLLDE SLESLKRIHE 1050
    VQEEMKNKEQ WDQLPRDQQQ ARQSQLAQDE RVSRSYLALA TETVDMFHIL 1100
    TKQVQKPFLR PELGPRLAAM LNFNLQQLCG PKCRDLKVEN PEKYGFEPKK 1150
    LLDQLTDIYL QLDCARFAKA IADDQRSYSK ELFEEVISKM RKAGIKSTIA 1200
    IEKFKLLAEK VEEIVAKNAR AEIDYSDAPD EFRDPLMDTL MTDPVRLPSG 1250
    TIMDRSIILR HLLNSPTDPF NRQTLTESML EPVPELKEQI QAWMREKQNS 1300
    DH 1302
    Length:1,302
    Mass (Da):146,185
    Last modified:May 1, 1999 - v1
    Checksum:i6BAA80984B03E43B
    GO
    Isoform 2 (identifier: O95155-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         270-398: Missing.

    Show »
    Length:1,173
    Mass (Da):133,275
    Checksum:iEBFE3FA2270B72B3
    GO
    Isoform 3 (identifier: O95155-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-116: Missing.
         270-398: Missing.
         1234-1234: D → GKWTH

    Note: No experimental confirmation available.

    Show »
    Length:1,061
    Mass (Da):121,820
    Checksum:iB4A29F16FFB1BD46
    GO
    Isoform 4 (identifier: O95155-4) [UniParc]FASTAAdd to Basket

    Also known as: UFD2a-7/7a, UFD2A-III

    The sequence of this isoform differs from the canonical sequence as follows:
         398-398: P → PSMYDNPFSFLFLALSGDSSDEEDEEEDDDDGDGDDEGGGGGDDFSCVQFGS

    Note: Expressed exclusively in mature striated muscle cells.

    Show »
    Length:1,353
    Mass (Da):151,561
    Checksum:i7D1745FEBDEA5B7C
    GO

    Sequence cautioni

    The sequence BAA31659.3 differs from that shown. Reason: Erroneous initiation.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti605 – 6051V → I.
    Corresponds to variant rs17034499 [ dbSNP | Ensembl ].
    VAR_052437

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 116116Missing in isoform 3. CuratedVSP_007101Add
    BLAST
    Alternative sequencei270 – 398129Missing in isoform 2 and isoform 3. 5 PublicationsVSP_007102Add
    BLAST
    Alternative sequencei398 – 3981P → PSMYDNPFSFLFLALSGDSS DEEDEEEDDDDGDGDDEGGG GGDDFSCVQFGS in isoform 4. 1 PublicationVSP_053372
    Alternative sequencei1234 – 12341D → GKWTH in isoform 3. CuratedVSP_007103

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF043117 mRNA. Translation: AAD02233.1.
    AB028839 mRNA. Translation: BAB40446.1.
    AF331520 mRNA. Translation: AAK69622.1.
    JF289274 mRNA. Translation: AEK06331.1.
    AB014584 mRNA. Translation: BAA31659.3. Different initiation.
    AK292444 mRNA. Translation: BAF85133.1.
    AL590639, AL096841 Genomic DNA. Translation: CAI14687.1.
    AL590639, AL096841 Genomic DNA. Translation: CAI14688.1.
    AL096841, AL590639 Genomic DNA. Translation: CAI21859.1.
    AL096841, AL590639 Genomic DNA. Translation: CAI21860.1.
    BC093696 mRNA. Translation: AAH93696.1.
    AF091093 mRNA. Translation: AAC72962.1. Sequence problems.
    CCDSiCCDS110.1. [O95155-2]
    CCDS41245.1. [O95155-1]
    PIRiT00358.
    RefSeqiNP_001099032.1. NM_001105562.2. [O95155-1]
    NP_006039.2. NM_006048.4. [O95155-2]
    XP_005263479.1. XM_005263422.1. [O95155-4]
    UniGeneiHs.593974.

    Genome annotation databases

    EnsembliENST00000253251; ENSP00000253251; ENSG00000130939. [O95155-2]
    ENST00000343090; ENSP00000343001; ENSG00000130939. [O95155-1]
    GeneIDi10277.
    KEGGihsa:10277.
    UCSCiuc001aqr.4. human. [O95155-2]
    uc001aqs.4. human. [O95155-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF043117 mRNA. Translation: AAD02233.1 .
    AB028839 mRNA. Translation: BAB40446.1 .
    AF331520 mRNA. Translation: AAK69622.1 .
    JF289274 mRNA. Translation: AEK06331.1 .
    AB014584 mRNA. Translation: BAA31659.3 . Different initiation.
    AK292444 mRNA. Translation: BAF85133.1 .
    AL590639 , AL096841 Genomic DNA. Translation: CAI14687.1 .
    AL590639 , AL096841 Genomic DNA. Translation: CAI14688.1 .
    AL096841 , AL590639 Genomic DNA. Translation: CAI21859.1 .
    AL096841 , AL590639 Genomic DNA. Translation: CAI21860.1 .
    BC093696 mRNA. Translation: AAH93696.1 .
    AF091093 mRNA. Translation: AAC72962.1 . Sequence problems.
    CCDSi CCDS110.1. [O95155-2 ]
    CCDS41245.1. [O95155-1 ]
    PIRi T00358.
    RefSeqi NP_001099032.1. NM_001105562.2. [O95155-1 ]
    NP_006039.2. NM_006048.4. [O95155-2 ]
    XP_005263479.1. XM_005263422.1. [O95155-4 ]
    UniGenei Hs.593974.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2KRE NMR - A 1208-1302 [» ]
    3L1X X-ray 2.60 A 1208-1302 [» ]
    3L1Z X-ray 3.17 B 1208-1302 [» ]
    ProteinModelPortali O95155.
    SMRi O95155. Positions 1223-1300.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115566. 66 interactions.
    DIPi DIP-40309N.
    IntActi O95155. 6 interactions.
    MINTi MINT-2798575.
    STRINGi 9606.ENSP00000343001.

    PTM databases

    PhosphoSitei O95155.

    Proteomic databases

    MaxQBi O95155.
    PaxDbi O95155.
    PRIDEi O95155.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000253251 ; ENSP00000253251 ; ENSG00000130939 . [O95155-2 ]
    ENST00000343090 ; ENSP00000343001 ; ENSG00000130939 . [O95155-1 ]
    GeneIDi 10277.
    KEGGi hsa:10277.
    UCSCi uc001aqr.4. human. [O95155-2 ]
    uc001aqs.4. human. [O95155-1 ]

    Organism-specific databases

    CTDi 10277.
    GeneCardsi GC01P010092.
    HGNCi HGNC:12500. UBE4B.
    HPAi HPA019219.
    MIMi 613565. gene.
    neXtProti NX_O95155.
    PharmGKBi PA37148.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5113.
    HOGENOMi HOG000294109.
    HOVERGENi HBG058129.
    InParanoidi O95155.
    KOi K10597.
    OMAi TENMLEP.
    OrthoDBi EOG7TXKFT.
    PhylomeDBi O95155.
    TreeFami TF300802.

    Miscellaneous databases

    ChiTaRSi UBE4B. human.
    EvolutionaryTracei O95155.
    GeneWikii UBE4B.
    GenomeRNAii 10277.
    NextBioi 35514999.
    PMAP-CutDB O95155.
    PROi O95155.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O95155.
    Bgeei O95155.
    CleanExi HS_UBE4B.
    Genevestigatori O95155.

    Family and domain databases

    Gene3Di 3.30.40.10. 1 hit.
    InterProi IPR019474. Ub_conjug_fac_E4_core.
    IPR003613. Ubox_domain.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    Pfami PF04564. U-box. 1 hit.
    PF10408. Ufd2P_core. 1 hit.
    [Graphical view ]
    SMARTi SM00504. Ubox. 1 hit.
    [Graphical view ]
    PROSITEi PS51698. U_BOX. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and expression analysis of five novel genes in chromosome 1p36."
      Onyango P., Lubyova B., Gardellin P., Kurzbauer R., Weith A.
      Genomics 50:187-198(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Substantia nigra.
    3. "The human homologue of the yeast polyubiquitination factor Ufd2p is cleaved by caspase 6 and granzyme B during apoptosis."
      Mahoney J.A., Odin J.A., White S.M., Shaffer D., Koff A., Casciola-Rosen L., Rosen A.
      Biochem. J. 361:587-595(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, MUTAGENESIS OF ASP-109; ASP-121 AND ASP-123, CLEAVAGE BY CASPASES.
    4. "A novel conserved isoform of the ubiquitin ligase UFD2a/UBE4B is expressed exclusively in mature striated muscle cells."
      Mammen A.L., Mahoney J.A., St Germain A., Badders N., Taylor J.P., Rosen A., Spinette S.
      PLoS ONE 6:E28861-E28861(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), ALTERNATIVE SPLICING.
      Tissue: Skeletal muscle.
    5. "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    6. Ohara O., Suyama M., Nagase T., Ishikawa K.
      Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION.
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    8. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Cerebellum.
    10. "Full-insert sequence of mapped XREF EST."
      Barrow I.K.-P., Boguski M.S., Touchman J.W., Spencer F.
      Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1112-1302.
    11. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-803, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
      Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
      Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-31, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-803, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-31; SER-88; SER-90; SER-101 AND SER-803, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    16. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    17. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-84; SER-88; SER-90 AND SER-101, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    18. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-803 AND SER-1265, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    19. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    20. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-103 AND SER-803, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    21. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    22. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiUBE4B_HUMAN
    AccessioniPrimary (citable) accession number: O95155
    Secondary accession number(s): A8K8S9
    , G0ZJH6, O75169, O95338, Q5SZ12, Q5SZ16, Q96QD4, Q9BYI7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 2002
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 124 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3