Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O95155

- UBE4B_HUMAN

UniProt

O95155 - UBE4B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Ubiquitin conjugation factor E4 B

Gene

UBE4B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Ubiquitin-protein ligase that probably functions as an E3 ligase in conjunction with specific E1 and E2 ligases. May also function as an E4 ligase mediating the assembly of polyubiquitin chains on substrates ubiquitinated by another E3 ubiquitin ligase.By similarity

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei109 – 1102Cleavage; by caspase-3 and caspase-7
Sitei123 – 1242Cleavage; by caspase-6 and granzyme B

GO - Molecular functioni

  1. enzyme binding Source: UniProtKB
  2. ubiquitin-ubiquitin ligase activity Source: InterPro

GO - Biological processi

  1. granzyme-mediated apoptotic signaling pathway Source: UniProtKB
  2. proteasome-mediated ubiquitin-dependent protein catabolic process Source: MGI
  3. protein ubiquitination involved in ubiquitin-dependent protein catabolic process Source: UniProtKB
  4. response to UV Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin conjugation factor E4 BCurated (EC:6.3.2.-By similarity)
Alternative name(s):
Homozygously deleted in neuroblastoma 1Imported
Ubiquitin fusion degradation protein 2Imported
Gene namesi
Name:UBE4BImported
Synonyms:HDNB1Imported, KIAA0684Imported, UFD2Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:12500. UBE4B.

Subcellular locationi

Cytoplasm By similarity. Nucleus By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. ubiquitin ligase complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi109 – 1091D → A: Abolishes cleavage by caspase-3 and caspase-7. 1 Publication
Mutagenesisi121 – 1211D → A: Abolishes cleavage by caspase-6. No effect on cleavage by granzyme B. 1 Publication
Mutagenesisi123 – 1231D → A: Abolishes cleavage by caspase-6 and granzyme B. 1 Publication

Organism-specific databases

PharmGKBiPA37148.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13021302Ubiquitin conjugation factor E4 BPRO_0000194993Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine2 Publications
Modified residuei31 – 311Phosphoserine2 Publications
Modified residuei84 – 841Phosphoserine1 Publication
Modified residuei88 – 881Phosphoserine2 Publications
Modified residuei90 – 901Phosphoserine2 Publications
Modified residuei101 – 1011Phosphoserine2 Publications
Modified residuei103 – 1031Phosphoserine1 Publication
Modified residuei803 – 8031Phosphoserine5 Publications
Modified residuei1265 – 12651Phosphoserine1 Publication

Post-translational modificationi

Proteolytically cleaved by caspases during apoptosis. Cleaved efficiently at Asp-123 by caspase-6 and granzyme B. Cleaved with approximately 10-fold less efficiency at Asp-109 by caspase-3 and caspase-7.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiO95155.
PaxDbiO95155.
PRIDEiO95155.

PTM databases

PhosphoSiteiO95155.

Miscellaneous databases

PMAP-CutDBO95155.

Expressioni

Tissue specificityi

Highest expression in ovary, testis, heart and skeletal muscle. Expression is low in colon, thymus and peripheral blood leukocytes. Almost undetectable in lung and spleen.1 Publication

Gene expression databases

BgeeiO95155.
CleanExiHS_UBE4B.
ExpressionAtlasiO95155. baseline and differential.
GenevestigatoriO95155.

Organism-specific databases

HPAiHPA019219.

Interactioni

Subunit structurei

Interacts with VCP.By similarity

Protein-protein interaction databases

BioGridi115566. 66 interactions.
DIPiDIP-40309N.
IntActiO95155. 6 interactions.
MINTiMINT-2798575.
STRINGi9606.ENSP00000343001.

Structurei

Secondary structure

1
1302
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi1230 – 12323Combined sources
Turni1235 – 12373Combined sources
Beta strandi1242 – 12465Combined sources
Turni1248 – 12503Combined sources
Beta strandi1252 – 12543Combined sources
Helixi1255 – 126410Combined sources
Turni1269 – 12713Combined sources
Helixi1277 – 12793Combined sources
Helixi1284 – 129815Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2KRENMR-A1208-1302[»]
3L1XX-ray2.60A1208-1302[»]
3L1ZX-ray3.17B1208-1302[»]
ProteinModelPortaliO95155.
SMRiO95155. Positions 1223-1300.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO95155.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1227 – 130074U-boxAdd
BLAST

Domaini

The U-box domain is required for the ubiquitin protein ligase activity.By similarity

Sequence similaritiesi

Contains 1 U-box domain.Curated

Phylogenomic databases

eggNOGiCOG5113.
GeneTreeiENSGT00390000009300.
HOGENOMiHOG000294109.
HOVERGENiHBG058129.
InParanoidiO95155.
KOiK10597.
OMAiTENMLEP.
OrthoDBiEOG7TXKFT.
PhylomeDBiO95155.
TreeFamiTF300802.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR019474. Ub_conjug_fac_E4_core.
IPR003613. Ubox_domain.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF04564. U-box. 1 hit.
PF10408. Ufd2P_core. 1 hit.
[Graphical view]
SMARTiSM00504. Ubox. 1 hit.
[Graphical view]
PROSITEiPS51698. U_BOX. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O95155-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEELSADEIR RRRLARLAGG QTSQPTTPLT SPQRENPPGP PIAASAPGPS
60 70 80 90 100
QSLGLNVHNM TPATSPIGAS GVAHRSQSSE GVSSLSSSPS NSLETQSQSL
110 120 130 140 150
SRSQSMDIDG VSCEKSMSQV DVDSGIENME VDENDRREKR SLSDKEPSSG
160 170 180 190 200
PEVSEEQALQ LVCKIFRVSW KDRDRDVIFL SSLSAQFKQN PKEVFSDFKD
210 220 230 240 250
LIGQILMEVL MMSTQTRDEN PFASLTATSQ PIAAAARSPD RNLLLNTGSN
260 270 280 290 300
PGTSPMFCSV ASFGASSLSS LYESSPAPTP SFWSSVPVMG PSLASPSRAA
310 320 330 340 350
SQLAVPSTPL SPHSAASGTA AGSQPSSPRY RPYTVTHPWA SSGVSILSSS
360 370 380 390 400
PSPPALASSP QAVPASSSRQ RPSSTGPPLP PASPSATSRR PSSLRISPSL
410 420 430 440 450
GASGGASNWD SYSDHFTIET CKETDMLNYL IECFDRVGIE EKKAPKMCSQ
460 470 480 490 500
PAVSQLLSNI RSQCISHTAL VLQGSLTQPR SLQQPSFLVP YMLCRNLPYG
510 520 530 540 550
FIQELVRTTH QDEEVFKQIF IPILQGLALA AKECSLDSDY FKYPLMALGE
560 570 580 590 600
LCETKFGKTH PVCNLVASLR LWLPKSLSPG CGRELQRLSY LGAFFSFSVF
610 620 630 640 650
AEDDVKVVEK YFSGPAITLE NTRVVSQSLQ HYLELGRQEL FKILHSILLN
660 670 680 690 700
GETREAALSY MAAVVNANMK KAQMQTDDRL VSTDGFMLNF LWVLQQLSTK
710 720 730 740 750
IKLETVDPTY IFHPRCRITL PNDETRVNAT MEDVNDWLTE LYGDQPPFSE
760 770 780 790 800
PKFPTECFFL TLHAHHLSIL PSCRRYIRRL RAIRELNRTV EDLKNNESQW
810 820 830 840 850
KDSPLATRHR EMLKRCKTQL KKLVRCKACA DAGLLDESFL RRCLNFYGLL
860 870 880 890 900
IQLLLRILDP AYPDITLPLN SDVPKVFAAL PEFYVEDVAE FLFFIVQYSP
910 920 930 940 950
QALYEPCTQD IVMFLVVMLC NQNYIRNPYL VAKLVEVMFM TNPAVQPRTQ
960 970 980 990 1000
KFFEMIENHP LSTKLLVPSL MKFYTDVEHT GATSEFYDKF TIRYHISTIF
1010 1020 1030 1040 1050
KSLWQNIAHH GTFMEEFNSG KQFVRYINML INDTTFLLDE SLESLKRIHE
1060 1070 1080 1090 1100
VQEEMKNKEQ WDQLPRDQQQ ARQSQLAQDE RVSRSYLALA TETVDMFHIL
1110 1120 1130 1140 1150
TKQVQKPFLR PELGPRLAAM LNFNLQQLCG PKCRDLKVEN PEKYGFEPKK
1160 1170 1180 1190 1200
LLDQLTDIYL QLDCARFAKA IADDQRSYSK ELFEEVISKM RKAGIKSTIA
1210 1220 1230 1240 1250
IEKFKLLAEK VEEIVAKNAR AEIDYSDAPD EFRDPLMDTL MTDPVRLPSG
1260 1270 1280 1290 1300
TIMDRSIILR HLLNSPTDPF NRQTLTESML EPVPELKEQI QAWMREKQNS

DH
Length:1,302
Mass (Da):146,185
Last modified:May 1, 1999 - v1
Checksum:i6BAA80984B03E43B
GO
Isoform 2 (identifier: O95155-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     270-398: Missing.

Show »
Length:1,173
Mass (Da):133,275
Checksum:iEBFE3FA2270B72B3
GO
Isoform 3 (identifier: O95155-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-116: Missing.
     270-398: Missing.
     1234-1234: D → GKWTH

Note: No experimental confirmation available.

Show »
Length:1,061
Mass (Da):121,820
Checksum:iB4A29F16FFB1BD46
GO
Isoform 4 (identifier: O95155-4) [UniParc]FASTAAdd to Basket

Also known as: UFD2a-7/7a, UFD2A-III

The sequence of this isoform differs from the canonical sequence as follows:
     398-398: P → PSMYDNPFSFLFLALSGDSSDEEDEEEDDDDGDGDDEGGGGGDDFSCVQFGS

Note: Expressed exclusively in mature striated muscle cells.

Show »
Length:1,353
Mass (Da):151,561
Checksum:i7D1745FEBDEA5B7C
GO

Sequence cautioni

The sequence BAA31659.3 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti605 – 6051V → I.
Corresponds to variant rs17034499 [ dbSNP | Ensembl ].
VAR_052437

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 116116Missing in isoform 3. CuratedVSP_007101Add
BLAST
Alternative sequencei270 – 398129Missing in isoform 2 and isoform 3. 5 PublicationsVSP_007102Add
BLAST
Alternative sequencei398 – 3981P → PSMYDNPFSFLFLALSGDSS DEEDEEEDDDDGDGDDEGGG GGDDFSCVQFGS in isoform 4. 1 PublicationVSP_053372
Alternative sequencei1234 – 12341D → GKWTH in isoform 3. CuratedVSP_007103

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF043117 mRNA. Translation: AAD02233.1.
AB028839 mRNA. Translation: BAB40446.1.
AF331520 mRNA. Translation: AAK69622.1.
JF289274 mRNA. Translation: AEK06331.1.
AB014584 mRNA. Translation: BAA31659.3. Different initiation.
AK292444 mRNA. Translation: BAF85133.1.
AL590639, AL096841 Genomic DNA. Translation: CAI14687.1.
AL590639, AL096841 Genomic DNA. Translation: CAI14688.1.
AL096841, AL590639 Genomic DNA. Translation: CAI21859.1.
AL096841, AL590639 Genomic DNA. Translation: CAI21860.1.
BC093696 mRNA. Translation: AAH93696.1.
AF091093 mRNA. Translation: AAC72962.1. Sequence problems.
CCDSiCCDS110.1. [O95155-2]
CCDS41245.1. [O95155-1]
PIRiT00358.
RefSeqiNP_001099032.1. NM_001105562.2. [O95155-1]
NP_006039.2. NM_006048.4. [O95155-2]
XP_005263479.1. XM_005263422.1. [O95155-4]
UniGeneiHs.593974.

Genome annotation databases

EnsembliENST00000253251; ENSP00000253251; ENSG00000130939. [O95155-2]
ENST00000343090; ENSP00000343001; ENSG00000130939. [O95155-1]
GeneIDi10277.
KEGGihsa:10277.
UCSCiuc001aqr.4. human. [O95155-2]
uc001aqs.4. human. [O95155-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF043117 mRNA. Translation: AAD02233.1 .
AB028839 mRNA. Translation: BAB40446.1 .
AF331520 mRNA. Translation: AAK69622.1 .
JF289274 mRNA. Translation: AEK06331.1 .
AB014584 mRNA. Translation: BAA31659.3 . Different initiation.
AK292444 mRNA. Translation: BAF85133.1 .
AL590639 , AL096841 Genomic DNA. Translation: CAI14687.1 .
AL590639 , AL096841 Genomic DNA. Translation: CAI14688.1 .
AL096841 , AL590639 Genomic DNA. Translation: CAI21859.1 .
AL096841 , AL590639 Genomic DNA. Translation: CAI21860.1 .
BC093696 mRNA. Translation: AAH93696.1 .
AF091093 mRNA. Translation: AAC72962.1 . Sequence problems.
CCDSi CCDS110.1. [O95155-2 ]
CCDS41245.1. [O95155-1 ]
PIRi T00358.
RefSeqi NP_001099032.1. NM_001105562.2. [O95155-1 ]
NP_006039.2. NM_006048.4. [O95155-2 ]
XP_005263479.1. XM_005263422.1. [O95155-4 ]
UniGenei Hs.593974.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2KRE NMR - A 1208-1302 [» ]
3L1X X-ray 2.60 A 1208-1302 [» ]
3L1Z X-ray 3.17 B 1208-1302 [» ]
ProteinModelPortali O95155.
SMRi O95155. Positions 1223-1300.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115566. 66 interactions.
DIPi DIP-40309N.
IntActi O95155. 6 interactions.
MINTi MINT-2798575.
STRINGi 9606.ENSP00000343001.

PTM databases

PhosphoSitei O95155.

Proteomic databases

MaxQBi O95155.
PaxDbi O95155.
PRIDEi O95155.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000253251 ; ENSP00000253251 ; ENSG00000130939 . [O95155-2 ]
ENST00000343090 ; ENSP00000343001 ; ENSG00000130939 . [O95155-1 ]
GeneIDi 10277.
KEGGi hsa:10277.
UCSCi uc001aqr.4. human. [O95155-2 ]
uc001aqs.4. human. [O95155-1 ]

Organism-specific databases

CTDi 10277.
GeneCardsi GC01P010092.
HGNCi HGNC:12500. UBE4B.
HPAi HPA019219.
MIMi 613565. gene.
neXtProti NX_O95155.
PharmGKBi PA37148.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5113.
GeneTreei ENSGT00390000009300.
HOGENOMi HOG000294109.
HOVERGENi HBG058129.
InParanoidi O95155.
KOi K10597.
OMAi TENMLEP.
OrthoDBi EOG7TXKFT.
PhylomeDBi O95155.
TreeFami TF300802.

Enzyme and pathway databases

UniPathwayi UPA00143 .

Miscellaneous databases

ChiTaRSi UBE4B. human.
EvolutionaryTracei O95155.
GeneWikii UBE4B.
GenomeRNAii 10277.
NextBioi 35514999.
PMAP-CutDB O95155.
PROi O95155.
SOURCEi Search...

Gene expression databases

Bgeei O95155.
CleanExi HS_UBE4B.
ExpressionAtlasi O95155. baseline and differential.
Genevestigatori O95155.

Family and domain databases

Gene3Di 3.30.40.10. 1 hit.
InterProi IPR019474. Ub_conjug_fac_E4_core.
IPR003613. Ubox_domain.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF04564. U-box. 1 hit.
PF10408. Ufd2P_core. 1 hit.
[Graphical view ]
SMARTi SM00504. Ubox. 1 hit.
[Graphical view ]
PROSITEi PS51698. U_BOX. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and expression analysis of five novel genes in chromosome 1p36."
    Onyango P., Lubyova B., Gardellin P., Kurzbauer R., Weith A.
    Genomics 50:187-198(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Substantia nigra.
  3. "The human homologue of the yeast polyubiquitination factor Ufd2p is cleaved by caspase 6 and granzyme B during apoptosis."
    Mahoney J.A., Odin J.A., White S.M., Shaffer D., Koff A., Casciola-Rosen L., Rosen A.
    Biochem. J. 361:587-595(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, MUTAGENESIS OF ASP-109; ASP-121 AND ASP-123, CLEAVAGE BY CASPASES.
  4. "A novel conserved isoform of the ubiquitin ligase UFD2a/UBE4B is expressed exclusively in mature striated muscle cells."
    Mammen A.L., Mahoney J.A., St Germain A., Badders N., Taylor J.P., Rosen A., Spinette S.
    PLoS ONE 6:E28861-E28861(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), ALTERNATIVE SPLICING.
    Tissue: Skeletal muscle.
  5. "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  6. Ohara O., Suyama M., Nagase T., Ishikawa K.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  8. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Cerebellum.
  10. "Full-insert sequence of mapped XREF EST."
    Barrow I.K.-P., Boguski M.S., Touchman J.W., Spencer F.
    Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1112-1302.
  11. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-803, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-31, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-803, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-31; SER-88; SER-90; SER-101 AND SER-803, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  16. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  17. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-84; SER-88; SER-90 AND SER-101, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  18. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-803 AND SER-1265, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  19. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  20. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-103 AND SER-803, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  21. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  22. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiUBE4B_HUMAN
AccessioniPrimary (citable) accession number: O95155
Secondary accession number(s): A8K8S9
, G0ZJH6, O75169, O95338, Q5SZ12, Q5SZ16, Q96QD4, Q9BYI7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 2002
Last sequence update: May 1, 1999
Last modified: November 26, 2014
This is version 126 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3