Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin conjugation factor E4 B

Gene

UBE4B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Ubiquitin-protein ligase that probably functions as an E3 ligase in conjunction with specific E1 and E2 ligases. May also function as an E4 ligase mediating the assembly of polyubiquitin chains on substrates ubiquitinated by another E3 ubiquitin ligase.By similarity

Catalytic activityi

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N6-ubiquitinyl-[acceptor protein]-L-lysine.

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.By similarity
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway

Enzyme and pathway databases

BRENDAi2.3.2.B12 2681
UniPathwayiUPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin conjugation factor E4 BCurated (EC:2.3.2.27By similarity)
Alternative name(s):
Homozygously deleted in neuroblastoma 1Imported
RING-type E3 ubiquitin transferase E4 B
Ubiquitin fusion degradation protein 2Imported
Gene namesi
Name:UBE4BImported
Synonyms:HDNB1Imported, KIAA0684Imported, UFD2Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000130939.18
HGNCiHGNC:12500 UBE4B
MIMi613565 gene
neXtProtiNX_O95155

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi109D → A: Abolishes cleavage by caspase-3 and caspase-7. 1 Publication1
Mutagenesisi121D → A: Abolishes cleavage by caspase-6. No effect on cleavage by granzyme B. 1 Publication1
Mutagenesisi123D → A: Abolishes cleavage by caspase-6 and granzyme B. 1 Publication1

Organism-specific databases

DisGeNETi10277
OpenTargetsiENSG00000130939
PharmGKBiPA37148

Polymorphism and mutation databases

BioMutaiUBE4B

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001949931 – 1302Ubiquitin conjugation factor E4 BAdd BLAST1302

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei23PhosphoserineCombined sources1
Modified residuei31PhosphoserineCombined sources1
Modified residuei84PhosphoserineCombined sources1
Modified residuei88PhosphoserineCombined sources1
Modified residuei90PhosphoserineCombined sources1
Modified residuei101PhosphoserineCombined sources1
Modified residuei103PhosphoserineCombined sources1
Modified residuei105PhosphoserineCombined sources1
Modified residuei124PhosphoserineCombined sources1
Modified residuei238PhosphoserineCombined sources1
Modified residuei383PhosphoserineCombined sources1
Modified residuei803PhosphoserineCombined sources1
Modified residuei969PhosphoserineBy similarity1
Modified residuei1265PhosphoserineCombined sources1

Post-translational modificationi

Proteolytically cleaved by caspases during apoptosis. Cleaved efficiently at Asp-123 by caspase-6 and granzyme B. Cleaved with approximately 10-fold less efficiency at Asp-109 by caspase-3 and caspase-7.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei109 – 110Cleavage; by caspase-3 and caspase-72
Sitei123 – 124Cleavage; by caspase-6 and granzyme B2

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO95155
MaxQBiO95155
PaxDbiO95155
PeptideAtlasiO95155
PRIDEiO95155

PTM databases

iPTMnetiO95155
PhosphoSitePlusiO95155

Miscellaneous databases

PMAP-CutDBO95155

Expressioni

Tissue specificityi

Highest expression in ovary, testis, heart and skeletal muscle. Expression is low in colon, thymus and peripheral blood leukocytes. Almost undetectable in lung and spleen.1 Publication

Gene expression databases

BgeeiENSG00000130939
CleanExiHS_UBE4B
ExpressionAtlasiO95155 baseline and differential
GenevisibleiO95155 HS

Organism-specific databases

HPAiHPA019219

Interactioni

Subunit structurei

Interacts with VCP.By similarity

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115566, 82 interactors
DIPiDIP-40309N
IntActiO95155, 11 interactors
MINTiO95155
STRINGi9606.ENSP00000343001

Structurei

Secondary structure

11302
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi1230 – 1232Combined sources3
Turni1235 – 1237Combined sources3
Beta strandi1242 – 1246Combined sources5
Turni1248 – 1250Combined sources3
Beta strandi1252 – 1254Combined sources3
Helixi1255 – 1264Combined sources10
Turni1269 – 1271Combined sources3
Helixi1277 – 1279Combined sources3
Helixi1284 – 1294Combined sources11
Turni1296 – 1298Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KRENMR-A1208-1302[»]
3L1XX-ray2.60A1208-1302[»]
3L1ZX-ray3.17B1208-1302[»]
5O75X-ray1.48A1226-1302[»]
ProteinModelPortaliO95155
SMRiO95155
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO95155

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1227 – 1300U-boxAdd BLAST74

Domaini

The U-box domain is required for the ubiquitin protein ligase activity.By similarity

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2042 Eukaryota
COG5113 LUCA
GeneTreeiENSGT00390000009300
HOGENOMiHOG000294109
HOVERGENiHBG058129
InParanoidiO95155
KOiK10597
OMAiAMWNHEL
OrthoDBiEOG091G02B4
PhylomeDBiO95155
TreeFamiTF300802

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR019474 Ub_conjug_fac_E4_core
IPR003613 Ubox_domain
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF04564 U-box, 1 hit
PF10408 Ufd2P_core, 1 hit
SMARTiView protein in SMART
SM00504 Ubox, 1 hit
PROSITEiView protein in PROSITE
PS51698 U_BOX, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95155-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEELSADEIR RRRLARLAGG QTSQPTTPLT SPQRENPPGP PIAASAPGPS
60 70 80 90 100
QSLGLNVHNM TPATSPIGAS GVAHRSQSSE GVSSLSSSPS NSLETQSQSL
110 120 130 140 150
SRSQSMDIDG VSCEKSMSQV DVDSGIENME VDENDRREKR SLSDKEPSSG
160 170 180 190 200
PEVSEEQALQ LVCKIFRVSW KDRDRDVIFL SSLSAQFKQN PKEVFSDFKD
210 220 230 240 250
LIGQILMEVL MMSTQTRDEN PFASLTATSQ PIAAAARSPD RNLLLNTGSN
260 270 280 290 300
PGTSPMFCSV ASFGASSLSS LYESSPAPTP SFWSSVPVMG PSLASPSRAA
310 320 330 340 350
SQLAVPSTPL SPHSAASGTA AGSQPSSPRY RPYTVTHPWA SSGVSILSSS
360 370 380 390 400
PSPPALASSP QAVPASSSRQ RPSSTGPPLP PASPSATSRR PSSLRISPSL
410 420 430 440 450
GASGGASNWD SYSDHFTIET CKETDMLNYL IECFDRVGIE EKKAPKMCSQ
460 470 480 490 500
PAVSQLLSNI RSQCISHTAL VLQGSLTQPR SLQQPSFLVP YMLCRNLPYG
510 520 530 540 550
FIQELVRTTH QDEEVFKQIF IPILQGLALA AKECSLDSDY FKYPLMALGE
560 570 580 590 600
LCETKFGKTH PVCNLVASLR LWLPKSLSPG CGRELQRLSY LGAFFSFSVF
610 620 630 640 650
AEDDVKVVEK YFSGPAITLE NTRVVSQSLQ HYLELGRQEL FKILHSILLN
660 670 680 690 700
GETREAALSY MAAVVNANMK KAQMQTDDRL VSTDGFMLNF LWVLQQLSTK
710 720 730 740 750
IKLETVDPTY IFHPRCRITL PNDETRVNAT MEDVNDWLTE LYGDQPPFSE
760 770 780 790 800
PKFPTECFFL TLHAHHLSIL PSCRRYIRRL RAIRELNRTV EDLKNNESQW
810 820 830 840 850
KDSPLATRHR EMLKRCKTQL KKLVRCKACA DAGLLDESFL RRCLNFYGLL
860 870 880 890 900
IQLLLRILDP AYPDITLPLN SDVPKVFAAL PEFYVEDVAE FLFFIVQYSP
910 920 930 940 950
QALYEPCTQD IVMFLVVMLC NQNYIRNPYL VAKLVEVMFM TNPAVQPRTQ
960 970 980 990 1000
KFFEMIENHP LSTKLLVPSL MKFYTDVEHT GATSEFYDKF TIRYHISTIF
1010 1020 1030 1040 1050
KSLWQNIAHH GTFMEEFNSG KQFVRYINML INDTTFLLDE SLESLKRIHE
1060 1070 1080 1090 1100
VQEEMKNKEQ WDQLPRDQQQ ARQSQLAQDE RVSRSYLALA TETVDMFHIL
1110 1120 1130 1140 1150
TKQVQKPFLR PELGPRLAAM LNFNLQQLCG PKCRDLKVEN PEKYGFEPKK
1160 1170 1180 1190 1200
LLDQLTDIYL QLDCARFAKA IADDQRSYSK ELFEEVISKM RKAGIKSTIA
1210 1220 1230 1240 1250
IEKFKLLAEK VEEIVAKNAR AEIDYSDAPD EFRDPLMDTL MTDPVRLPSG
1260 1270 1280 1290 1300
TIMDRSIILR HLLNSPTDPF NRQTLTESML EPVPELKEQI QAWMREKQNS

DH
Length:1,302
Mass (Da):146,185
Last modified:May 1, 1999 - v1
Checksum:i6BAA80984B03E43B
GO
Isoform 2 (identifier: O95155-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     270-398: Missing.

Show »
Length:1,173
Mass (Da):133,275
Checksum:iEBFE3FA2270B72B3
GO
Isoform 3 (identifier: O95155-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-116: Missing.
     270-398: Missing.
     1234-1234: D → GKWTH

Note: No experimental confirmation available.
Show »
Length:1,061
Mass (Da):121,820
Checksum:iB4A29F16FFB1BD46
GO
Isoform 4 (identifier: O95155-4) [UniParc]FASTAAdd to basket
Also known as: UFD2a-7/7a, UFD2A-III

The sequence of this isoform differs from the canonical sequence as follows:
     398-398: P → PSMYDNPFSFLFLALSGDSSDEEDEEEDDDDGDGDDEGGGGGDDFSCVQFGS

Note: Expressed exclusively in mature striated muscle cells.
Show »
Length:1,353
Mass (Da):151,561
Checksum:i7D1745FEBDEA5B7C
GO

Sequence cautioni

The sequence BAA31659 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_052437605V → I. Corresponds to variant dbSNP:rs17034499Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0071011 – 116Missing in isoform 3. CuratedAdd BLAST116
Alternative sequenceiVSP_007102270 – 398Missing in isoform 2 and isoform 3. 5 PublicationsAdd BLAST129
Alternative sequenceiVSP_053372398P → PSMYDNPFSFLFLALSGDSS DEEDEEEDDDDGDGDDEGGG GGDDFSCVQFGS in isoform 4. 1 Publication1
Alternative sequenceiVSP_0071031234D → GKWTH in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF043117 mRNA Translation: AAD02233.1
AB028839 mRNA Translation: BAB40446.1
AF331520 mRNA Translation: AAK69622.1
JF289274 mRNA Translation: AEK06331.1
AB014584 mRNA Translation: BAA31659.3 Different initiation.
AK292444 mRNA Translation: BAF85133.1
AL096841 Genomic DNA No translation available.
AL590639 Genomic DNA No translation available.
BC093696 mRNA Translation: AAH93696.1
AF091093 mRNA Translation: AAC72962.1 Sequence problems.
CCDSiCCDS110.1 [O95155-2]
CCDS41245.1 [O95155-1]
PIRiT00358
RefSeqiNP_001099032.1, NM_001105562.2 [O95155-1]
NP_006039.2, NM_006048.4 [O95155-2]
XP_005263479.1, XM_005263422.1 [O95155-4]
UniGeneiHs.593974

Genome annotation databases

EnsembliENST00000253251; ENSP00000253251; ENSG00000130939 [O95155-2]
ENST00000343090; ENSP00000343001; ENSG00000130939 [O95155-1]
GeneIDi10277
KEGGihsa:10277
UCSCiuc001aqr.5 human [O95155-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiUBE4B_HUMAN
AccessioniPrimary (citable) accession number: O95155
Secondary accession number(s): A8K8S9
, G0ZJH6, O75169, O95338, Q5SZ12, Q5SZ16, Q96QD4, Q9BYI7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 2002
Last sequence update: May 1, 1999
Last modified: May 23, 2018
This is version 162 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health