O95153 (RIMB1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Peripheral-type benzodiazepine receptor-associated protein 1 Short name=PRAX-1 Alternative name(s): Peripheral benzodiazepine receptor-interacting protein Short name=PBR-IP RIMS-binding protein 1 Short name=RIM-BP1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1857 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Interacts with RIMS1 and RIMS2 By similarity. Interacts with BZRP. Ref.1 |
| Subcellular location | Cytoplasm. Mitochondrion. Note: Preferentially expressed in the mitochondria in the presence of BZRP. Ref.1 |
| Tissue specificity | Predominantly expressed in brain, pituitary gland and thymus in adults. In adult brain, highest expression found in temporal lobe and the putamen, followed by amygdala, caudate nucleus, cerebral cortex, occipital and frontal lobe. A high expression level is also observed in fetal tissues like brain, heart, kidney and thymus. Ref.1 |
| Domain | The SH3 and proline-rich domain is required for the interaction with BZRP and the second SH3 domain mediates binding to a proline-rich motif in RIMS1 and RIMS2 By similarity. |
| Sequence similarities | Belongs to the RIMBP family. Contains 3 fibronectin type-III domains. Contains 3 SH3 domains. |
| Caution | Ref.1 demonstrated interaction with BZRP but later PubMed:12435798 demonstrated in the rat ortholog that is not associated with BZRP in the brain. |
| Sequence caution | The sequence BAA31587.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat SH3 domain |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | mitochondrion Inferred from direct assay Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CACNA1A | O00555 | 2 | EBI-5915931,EBI-766279 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O95153-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: O95153-2) The sequence of this isoform differs from the canonical sequence as follows: 191-250: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O95153-3) The sequence of this isoform differs from the canonical sequence as follows: 1849-1857: RTRRRRVQC → DWGCTTQGSPGPPGGPCTPSSGSAPRIERGEPQGRSEKVWGFFSKGKQLLRRLGSGKKE | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1857 | 1857 | Peripheral-type benzodiazepine receptor-associated protein 1 | PRO_0000221380 | |||||
Regions | |||||||||
| Domain | 653 – 720 | 68 | SH3 1 | ||||||
| Domain | 791 – 868 | 78 | Fibronectin type-III 1 | ||||||
| Domain | 882 – 955 | 74 | Fibronectin type-III 2 | ||||||
| Domain | 972 – 1066 | 95 | Fibronectin type-III 3 | ||||||
| Domain | 1625 – 1693 | 69 | SH3 2 | ||||||
| Domain | 1764 – 1831 | 68 | SH3 3 | ||||||
| Compositional bias | 1071 – 1150 | 80 | Pro-rich | ||||||
| Compositional bias | 1262 – 1274 | 13 | Poly-Glu | ||||||
| Compositional bias | 1334 – 1346 | 13 | Poly-Glu | ||||||
Amino acid modifications | |||||||||
| Modified residue | 424 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 191 – 250 | 60 | Missing in isoform 2. | VSP_009204 | |||||
| Alternative sequence | 1849 – 1857 | 9 | RTRRRRVQC → DWGCTTQGSPGPPGGPCTPS SGSAPRIERGEPQGRSEKVW GFFSKGKQLLRRLGSGKKE in isoform 3. | VSP_009205 | |||||
| Natural variant | 514 | 1 | Q → R. Corresponds to variant rs2072145 [ dbSNP | Ensembl ]. | VAR_017446 | |||||
| Natural variant | 586 | 1 | A → T. Corresponds to variant rs2072147 [ dbSNP | Ensembl ]. | VAR_017447 | |||||
| Natural variant | 817 | 1 | Q → R. Ref.2 Corresponds to variant rs9913145 [ dbSNP | Ensembl ]. | VAR_031662 | |||||
| Natural variant | 851 | 1 | W → R. Ref.2 Corresponds to variant rs9905604 [ dbSNP | Ensembl ]. | VAR_031663 | |||||
| Natural variant | 1118 | 1 | H → L. Ref.2 Corresponds to variant rs3744099 [ dbSNP | Ensembl ]. | VAR_017448 | |||||
| Natural variant | 1140 | 1 | A → P. Ref.2 Corresponds to variant rs2680704 [ dbSNP | Ensembl ]. | VAR_017449 | |||||
| Natural variant | 1253 | 1 | R → C. Corresponds to variant rs3744101 [ dbSNP | Ensembl ]. | VAR_017450 | |||||
| Natural variant | 1728 | 1 | H → R. Ref.2 Corresponds to variant rs11079346 [ dbSNP | Ensembl ]. | VAR_031664 | |||||
| Natural variant | 1830 | 1 | G → E. Corresponds to variant rs2301868 [ dbSNP | Ensembl ]. | VAR_017451 | |||||
Experimental info | |||||||||
| Sequence conflict | 1525 | 1 | G → R in AAD11957. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of PRAX-1. A new protein that specifically interacts with the peripheral benzodiazepine receptor." Galiegue S., Jbilo O., Combes T., Bribes E., Carayon P., Le Fur G., Casellas P. J. Biol. Chem. 274:2938-2952(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH BZRP. Tissue: Brain. |
| [2] | "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS ARG-817; ARG-851; LEU-1118; PRO-1140 AND ARG-1728. Tissue: Brain. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1737-1857 (ISOFORM 3). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF039571 mRNA. Translation: AAD11957.1. AB014512 mRNA. Translation: BAA31587.2. Different initiation. BC031401 mRNA. Translation: AAH31401.1. |
| IPI | IPI00006254. IPI00397514. IPI00397515. |
| PIR | T00391. |
| RefSeq | NP_001248764.1. NM_001261835.1. NP_004749.2. NM_004758.3. NP_077729.1. NM_024418.2. |
| UniGene | Hs.112499. |
3D structure databases | |
| ProteinModelPortal | O95153. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O95153. 1 interaction. |
| MINT | MINT-4132417. |
| STRING | 9606.ENSP00000345824. |
PTM databases | |
| PhosphoSite | O95153. |
Proteomic databases | |
| PaxDb | O95153. |
| PRIDE | O95153. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000268893; ENSP00000268893; ENSG00000005379. ENST00000343736; ENSP00000345824; ENSG00000005379. ENST00000355701; ENSP00000347929; ENSG00000005379. ENST00000581675; ENSP00000462518; ENSG00000005379. |
| GeneID | 9256. |
| KEGG | hsa:9256. |
| UCSC | uc002ivx.4. human. uc010dcs.3. human. |
Organism-specific databases | |
| CTD | 9256. |
| GeneCards | GC17M056379. |
| H-InvDB | HIX0014027. |
| HGNC | HGNC:16831. BZRAP1. |
| HPA | HPA024662. HPA025244. |
| MIM | 610764. gene. |
| neXtProt | NX_O95153. |
| PharmGKB | PA128394545. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG327664. |
| HOGENOM | HOG000139176. |
| HOVERGEN | HBG056664. |
| OMA | GSRTCSF. |
Gene expression databases | |
| Bgee | O95153. |
| CleanEx | HS_BZRAP1. HS_RBP1. |
| Genevestigator | O95153. |
| GermOnline | ENSG00000005379. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003961. Fibronectin_type3. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] |
| Pfam | PF07653. SH3_2. 3 hits. [Graphical view] |
| SMART | SM00060. FN3. 3 hits. SM00326. SH3. 3 hits. [Graphical view] |
| SUPFAM | SSF49265. FN_III-like. 1 hit. SSF50044. SH3. 3 hits. |
| PROSITE | PS50853. FN3. 3 hits. PS50002. SH3. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | O95153. |
| ChiTaRS | BZRAP1. human. |
| GenomeRNAi | 9256. |
| NextBio | 34699. |
| PMAP-CutDB | O95153. |
| SOURCE | Search... |
Entry information
| Entry name | RIMB1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95153 Secondary accession number(s): O75111, Q8N5W3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
