O95140 (MFN2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mitofusin-2 EC=3.6.5.- Alternative name(s): Transmembrane GTPase MFN2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 757 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Essential transmembrane GTPase, which mediates mitochondrial fusion. Fusion of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Overexpression induces the formation of mitochondrial networks. Plays an important role in the regulation of vascular smooth muscle cell proliferation. Ref.2 Ref.9 Ref.10 |
| Catalytic activity | GTP + H2O = GDP + phosphate. |
| Subunit structure | Forms homomultimers and heteromultimers with MFN1. Oligomerization, which is mediated by the second coiled coil region, may play an essential role in mitochondrion fusion. Interacts with VAT1 By similarity. Interacts with STOML2; may form heterooligomers. Ref.15 |
| Subcellular location | Mitochondrion outer membrane; Multi-pass membrane protein. Note: Colocalizes with BAX during apoptosis. Ref.9 Ref.10 Ref.11 |
| Tissue specificity | Ubiquitous; expressed at low level. Highly expressed in heart and kidney. Ref.10 Ref.12 |
| Involvement in disease | Charcot-Marie-Tooth disease 2A2 (CMT2A2) [MIM:609260]: An axonal form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Nerve conduction velocities are normal or slightly reduced. Charcot-Marie-Tooth disease 6 (CMT6) [MIM:601152]: A form of Charcot-Marie-Tooth disease characterized by the association of axonal peripheral neuropathy with optic atrophy. Charcot-Marie-Tooth disease is a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. It is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies and primary peripheral axonal neuropathies. Peripheral axonal neuropathies are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Nerve conduction velocities are normal or slightly reduced. |
| Sequence similarities | Belongs to the mitofusin family. |
| Sequence caution | The sequence BAA34389.2 differs from that shown. Reason: Erroneous initiation. The sequence CAB70866.2 differs from that shown. Reason: Frameshift at position 581. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O95140-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O95140-2) The sequence of this isoform differs from the canonical sequence as follows: 1-302: Missing. 303-324: FVSAKEVLNARIQKAQGMPEGG → MHPHLSTLSLPRRRSMAFLSSW 705-757: VTRENLEQEI...FTHQYLQPSR → GETLSERSMAKSTLMLLTLLFLCSFAGAQDVLTQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 757 | 757 | Mitofusin-2 | PRO_0000127675 | |||||
Regions | |||||||||
| Topological domain | 1 – 604 | 604 | Cytoplasmic Potential | ||||||
| Transmembrane | 605 – 625 | 21 | Helical; Name=1; Potential | ||||||
| Topological domain | 626 | 1 | Mitochondrial intermembrane Potential | ||||||
| Transmembrane | 627 – 647 | 21 | Helical; Name=2; Potential | ||||||
| Topological domain | 648 – 757 | 110 | Cytoplasmic Potential | ||||||
| Nucleotide binding | 103 – 110 | 8 | GTP Probable | ||||||
| Nucleotide binding | 199 – 203 | 5 | GTP Probable | ||||||
| Nucleotide binding | 258 – 261 | 4 | GTP Probable | ||||||
| Coiled coil | 391 – 434 | 44 | Potential | ||||||
| Coiled coil | 695 – 738 | 44 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 302 | 302 | Missing in isoform 2. | VSP_015159 | |||||
| Alternative sequence | 303 – 324 | 22 | FVSAK…MPEGG → MHPHLSTLSLPRRRSMAFLS SW in isoform 2. | VSP_015160 | |||||
| Alternative sequence | 705 – 757 | 53 | VTREN…LQPSR → GETLSERSMAKSTLMLLTLL FLCSFAGAQDVLTQ in isoform 2. | VSP_015161 | |||||
| Natural variant | 69 | 1 | V → F in CMT2A2; in a Turkish family. Ref.13 Corresponds to variant rs28940296 [ dbSNP | Ensembl ]. | VAR_018607 | |||||
| Natural variant | 76 | 1 | L → P in CMT2A2; in a European family. Ref.13 Corresponds to variant rs28940293 [ dbSNP | Ensembl ]. | VAR_018608 | |||||
| Natural variant | 94 | 1 | R → Q in CMT2A2; in a Japanese and Russian kindred. Ref.13 Corresponds to variant rs28940291 [ dbSNP | Ensembl ]. | VAR_018609 | |||||
| Natural variant | 94 | 1 | R → W in CMT6. Ref.18 | VAR_029876 | |||||
| Natural variant | 206 | 1 | T → I in CMT6. Ref.18 | VAR_029877 | |||||
| Natural variant | 233 | 1 | L → V in CMT2A2. Ref.19 | VAR_067088 | |||||
| Natural variant | 251 | 1 | P → A in CMT2A2. Ref.13 Corresponds to variant rs28940295 [ dbSNP | Ensembl ]. | VAR_018610 | |||||
| Natural variant | 276 | 1 | Q → R in CMT6. Ref.18 | VAR_029878 | |||||
| Natural variant | 280 | 1 | R → H in CMT2A2. Ref.13 Corresponds to variant rs28940294 [ dbSNP | Ensembl ]. | VAR_018611 | |||||
| Natural variant | 357 | 1 | K → N in CMT2A2. Ref.17 | VAR_022464 | |||||
| Natural variant | 361 | 1 | H → Y in CMT6. Ref.18 | VAR_029879 | |||||
| Natural variant | 364 | 1 | R → W in CMT6 and CMT2A2. Ref.18 Ref.19 | VAR_029880 | |||||
| Natural variant | 740 | 1 | W → S in CMT2A2; in a European family. Ref.13 Corresponds to variant rs28940292 [ dbSNP | Ensembl ]. | VAR_018612 | |||||
| Natural variant | 744 | 1 | E → M in CMT2A2; requires 2 nucleotide substitutions. Ref.19 | VAR_067089 | |||||
Experimental info | |||||||||
| Mutagenesis | 109 | 1 | K → A or T: Does not affect its ability to cluster mitochondria; when overexpressed. Ref.9 Ref.10 | ||||||
| Mutagenesis | 110 | 1 | S → N: Does not affect its ability to cluster mitochondria; when overexpressed. Ref.10 | ||||||
| Mutagenesis | 259 | 1 | R → L: Does not affect its ability to cluster mitochondria; when overexpressed. Ref.10 | ||||||
| Mutagenesis | 622 – 624 | 3 | GGV → AAL: Does not affect the targeting to mitochondrial outer membrane. Ref.9 | ||||||
| Mutagenesis | 622 – 624 | 3 | GGV → RRE: Abolishes the targeting to mitochondrial outer membrane. Ref.9 | ||||||
| Mutagenesis | 657 – 659 | 3 | KER → TGV: Does not affect the targeting to mitochondrial outer membrane. Ref.9 | ||||||
| Sequence conflict | 521 | 1 | C → P in AAD02058. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mitofusin-2 determines mitochondrial network architecture and mitochondrial metabolism. A novel regulatory mechanism altered in obesity." Bach D., Pich S., Soriano F.X., Vega N., Baumgartner B., Oriola J., Daugaard J.R., Lloberas J., Camps M., Zierath J.R., Rabasa-Lhoret R., Wallberg-Henriksson H., Laville M., Palacin M., Vidal H., Rivera F., Brand M., Zorzano A. J. Biol. Chem. 278:17190-17197(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Dysregulation of HSG triggers vascular proliferative disorders." Chen K.-H., Guo X., Ma D., Guo Y., Li Q., Yang D., Li P., Qiu X., Wen S., Xiao R.-P., Tang J. Nat. Cell Biol. 6:872-883(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, DISEASE. |
| [3] | "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain." Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N. DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pancreas. |
| [8] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 553-757 (ISOFORM 1). Tissue: Testis. |
| [9] | "Control of mitochondrial morphology by a human mitofusin." Santel A., Fuller M.T. J. Cell Sci. 114:867-874(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-109; 622-GLY--VAL-624 AND 657-LYS--ARG-659. |
| [10] | "Membrane topology and mitochondrial targeting of mitofusins, ubiquitous mammalian homologs of the transmembrane GTPase Fzo." Rojo M., Legros F., Chateau D., Lombes A. J. Cell Sci. 115:1663-1674(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, MEMBRANE TOPOLOGY, TISSUE SPECIFICITY, MUTAGENESIS OF LYS-109; SER-110 AND ARG-259. |
| [11] | "Spatial and temporal association of Bax with mitochondrial fission sites, Drp1, and Mfn2 during apoptosis." Karbowski M., Lee Y.-J., Gaume B., Jeong S.-Y., Frank S., Nechushtan A., Santel A., Fuller M., Smith C.L., Youle R.J. J. Cell Biol. 159:931-938(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [12] | "Mitofusin-1 protein is a generally expressed mediator of mitochondrial fusion in mammalian cells." Santel A., Frank S., Gaume B., Herrler M., Youle R.J., Fuller M.T. J. Cell Sci. 116:2763-2774(2003) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [13] | "Mutations in the mitochondrial GTPase mitofusin 2 cause Charcot-Marie-Tooth neuropathy type 2A." Zuechner S., Mersiyanova I.V., Muglia M., Bissar-Tadmouri N., Rochelle J., Dadali E.L., Zappia M., Nelis E., Patitucci A., Senderek J., Parman Y., Evgrafov O., Jonghe P.D., Takahashi Y., Tsuji S., Pericak-Vance M.A., Quattrone A., Battaloglu E. Vance J.M.Nat. Genet. 36:449-451(2004) [PubMed] [Europe PMC] [Abstract] Cited for: DISEASE, VARIANTS CMT2A2 PHE-69; PRO-76; GLN-94; ALA-251; HIS-280 AND SER-740. |
| [14] | Erratum Zuechner S., Mersiyanova I.V., Muglia M., Bissar-Tadmouri N., Rochelle J., Dadali E.L., Zappia M., Nelis E., Patitucci A., Senderek J., Parman Y., Evgrafov O., Jonghe P.D., Takahashi Y., Tsuji S., Pericak-Vance M.A., Quattrone A., Battaloglu E. Vance J.M.Nat. Genet. 36:660-660(2004) |
| [15] | "Identification of a novel mitochondrial complex containing mitofusin 2 and stomatin-like protein 2." Hajek P., Chomyn A., Attardi G. J. Biol. Chem. 282:5670-5681(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH STOML2. |
| [16] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [17] | "Mitochondrial GTPase mitofusin 2 mutation in Charcot-Marie-Tooth neuropathy type 2A." Kijima K., Numakura C., Izumino H., Umetsu K., Nezu A., Shiiki T., Ogawa M., Ishizaki Y., Kitamura T., Shozawa Y., Hayasaka K. Hum. Genet. 116:23-27(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT2A2 ASN-357. |
| [18] | "Axonal neuropathy with optic atrophy is caused by mutations in mitofusin 2." Zuechner S., De Jonghe P., Jordanova A., Claeys K.G., Guergueltcheva V., Cherninkova S., Hamilton S.R., Van Stavern G., Krajewski K.M., Stajich J., Tournev I., Verhoeven K., Langerhorst C.T., de Visser M., Baas F., Bird T., Timmerman V., Shy M., Vance J.M. Ann. Neurol. 59:276-281(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT6 TRP-94; ILE-206; ARG-276; TYR-361 AND TRP-364. |
| [19] | "The mutational spectrum in a cohort of Charcot-Marie-Tooth disease type 2 among the Han Chinese in Taiwan." Lin K.P., Soong B.W., Yang C.C., Huang L.W., Chang M.H., Lee I.H., Antonellis A., Lee Y.C. PLoS ONE 6:E29393-E29393(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT2A2 VAL-233; TRP-364 AND MET-744. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY028429 mRNA. Translation: AAK18728.1. AF036536 mRNA. Translation: AAD02058.2. D86987 mRNA. Translation: BAA34389.2. Different initiation. AK289828 mRNA. Translation: BAF82517.1. AL096840 Genomic DNA. Translation: CAI19087.2. AL096840 Genomic DNA. Translation: CAI19088.2. CH471130 Genomic DNA. Translation: EAW71726.1. BC017061 mRNA. Translation: AAH17061.1. AL137666 mRNA. Translation: CAB70866.2. Frameshift. |
| IPI | IPI00642329. IPI00902732. |
| PIR | T46498. |
| RefSeq | NP_001121132.1. NM_001127660.1. NP_055689.1. NM_014874.3. |
| UniGene | Hs.376681. |
3D structure databases | |
| ProteinModelPortal | O95140. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-42832N. |
| IntAct | O95140. 1 interaction. |
| MINT | MINT-3002608. |
| STRING | 9606.ENSP00000235329. |
Protein family/group databases | |
| TCDB | 9.B.25.2.1. mitochondrial inner/outer membrane fusion (MMF) family. |
PTM databases | |
| PhosphoSite | O95140. |
Proteomic databases | |
| PaxDb | O95140. |
| PRIDE | O95140. |
Protocols and materials databases | |
| DNASU | 9927. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000235329; ENSP00000235329; ENSG00000116688. ENST00000444836; ENSP00000416338; ENSG00000116688. |
| GeneID | 9927. |
| KEGG | hsa:9927. |
| UCSC | uc001atn.4. human. |
Organism-specific databases | |
| CTD | 9927. |
| GeneCards | GC01P012040. |
| HGNC | HGNC:16877. MFN2. |
| HPA | HPA030554. |
| MIM | 601152. phenotype. 608507. gene. 609260. phenotype. |
| neXtProt | NX_O95140. |
| Orphanet | 99947. Autosomal dominant Charcot-Marie-Tooth disease type 2A2. 90118. Autosomal recessive Charcot-Marie-Tooth disease, Ouvrier type. 64751. Hereditary motor and sensory neuropathy type 5. 90120. Hereditary motor and sensory neuropathy type 6. |
| PharmGKB | PA134986046. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0699. |
| HOGENOM | HOG000231098. |
| HOVERGEN | HBG052465. |
| InParanoid | O95140. |
| KO | K06030. |
| OMA | RVQKAQG. |
| OrthoDB | EOG43JC43. |
Enzyme and pathway databases | |
| Reactome | REACT_604. Hemostasis. |
Gene expression databases | |
| ArrayExpress | O95140. |
| Bgee | O95140. |
| CleanEx | HS_MFN2. |
| Genevestigator | O95140. |
| GermOnline | ENSG00000116688. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001401. Dynamin_GTPase. IPR006884. Fzo/mitofusin_HR2. IPR027089. Mitofusin-2. IPR027094. Mitofusin_fam. [Graphical view] |
| PANTHER | PTHR10465. PTHR10465. 1 hit. PTHR10465:SF1. PTHR10465:SF1. 1 hit. |
| Pfam | PF00350. Dynamin_N. 1 hit. PF04799. Fzo_mitofusin. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MFN2. human. |
| GenomeRNAi | 9927. |
| NextBio | 37454. |
| SOURCE | Search... |
Entry information
| Entry name | MFN2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95140 Secondary accession number(s): A8K1B3 Q9NSX8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
