O95045 (UPP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 99.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uridine phosphorylase 2 Short name=UPase 2 Short name=UrdPase 2 EC=2.4.2.3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 317 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates. |
| Catalytic activity | Uridine + phosphate = uracil + alpha-D-ribose 1-phosphate. |
| Enzyme regulation | A conditional disulfide bridge can form within the protein that dislocates a critical phosphate-coordinating arginine Arg-100 away from the active site, disabling the enzyme. Ref.5 |
| Pathway | |
| Tissue specificity | Predominantly expressed in kidney. Ref.1 |
| Sequence similarities | Belongs to the PNP/UDP phosphorylase family. |
| Sequence caution | The sequence AAH33529.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O95045-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O95045-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLAPGCELDPDQEVVRTRPEDVPASPSTSTMIVSVLRPPSHASCTACGTVTFHIVERM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 317 | 317 | Uridine phosphorylase 2 | PRO_0000063193 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 95 ↔ 102 | Redox-active Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MLAPGCELDPDQEVVRTRPE DVPASPSTSTMIVSVLRPPS HASCTACGTVTFHIVERM in isoform 2. | VSP_043756 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 10 | 1 | R → S. Corresponds to variant rs6710480 [ dbSNP | Ensembl ]. | VAR_024431 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 78 | 1 | M → L. Corresponds to variant rs7561584 [ dbSNP | Ensembl ]. | VAR_034580 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 153 | 1 | I → M in AAO61681. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 157 | 1 | T → R in AAO61681. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 256 – 262 | 7 | ESTVFAA → GIYSVCS in AAO61681. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 32 – 34 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 41 – 43 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 47 – 49 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 52 – 56 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 61 – 66 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 68 – 82 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 94 – 97 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 98 – 100 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 103 – 106 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 109 – 113 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 118 – 134 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 141 – 153 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 158 – 165 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 171 – 177 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 180 – 185 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 190 – 201 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 208 – 215 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 221 – 223 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 226 – 229 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 235 – 248 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 250 – 256 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 257 – 266 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 270 – 280 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 281 – 283 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 291 – 298 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 300 – 313 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel human uridine phosphorylase." Johansson M. Biochem. Biophys. Res. Commun. 307:41-46(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION, TISSUE SPECIFICITY. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [5] | "A novel structural mechanism for redox regulation of uridine phosphorylase 2 activity." Roosild T.P., Castronovo S., Villoso A., Ziemba A., Pizzorno G. J. Struct. Biol. 176:229-237(2011) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.54 ANGSTROMS) OF 21-314, ENZYME REGULATION, DISULFIDE BOND. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY225131 mRNA. Translation: AAO61681.1. AK122743 mRNA. Translation: BAG53699.1. AC005539 Genomic DNA. Translation: AAD12227.1. BC033529 mRNA. Translation: AAH33529.1. Different initiation. | ||||||||||||||||||||||||
| IPI | IPI00098522. | ||||||||||||||||||||||||
| RefSeq | NP_001128570.1. NM_001135098.1. NP_775491.1. NM_173355.3. | ||||||||||||||||||||||||
| UniGene | Hs.128427. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | O95045. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| STRING | 9606.ENSP00000387230. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | O95045. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | O95045. | ||||||||||||||||||||||||
| PRIDE | O95045. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 151531. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000005756; ENSP00000005756; ENSG00000007001. ENST00000409859; ENSP00000387230; ENSG00000007001. | ||||||||||||||||||||||||
| GeneID | 151531. | ||||||||||||||||||||||||
| KEGG | hsa:151531. | ||||||||||||||||||||||||
| UCSC | uc002tzo.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 151531. | ||||||||||||||||||||||||
| GeneCards | GC02P158815. | ||||||||||||||||||||||||
| HGNC | HGNC:23061. UPP2. | ||||||||||||||||||||||||
| HPA | HPA035225. HPA035226. | ||||||||||||||||||||||||
| neXtProt | NX_O95045. | ||||||||||||||||||||||||
| PharmGKB | PA134866434. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | COG2820. | ||||||||||||||||||||||||
| HOGENOM | HOG000231747. | ||||||||||||||||||||||||
| HOVERGEN | HBG047725. | ||||||||||||||||||||||||
| InParanoid | O95045. | ||||||||||||||||||||||||
| KO | K00757. | ||||||||||||||||||||||||
| OMA | VGKRFVH. | ||||||||||||||||||||||||
| OrthoDB | EOG412M66. | ||||||||||||||||||||||||
| PhylomeDB | O95045. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||||||||||||||
| SABIO-RK | O95045. | ||||||||||||||||||||||||
| SignaLink | O95045. | ||||||||||||||||||||||||
| UniPathway | UPA00574; UER00633. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| Bgee | O95045. | ||||||||||||||||||||||||
| CleanEx | HS_UPP2. | ||||||||||||||||||||||||
| Genevestigator | O95045. | ||||||||||||||||||||||||
| GermOnline | ENSG00000007001. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 3.40.50.1580. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR018017. Nucleoside_phosphorylase. IPR018016. Nucleoside_phosphorylase_CS. IPR000845. Nucleoside_phosphorylase_d. IPR010059. Uridine_phosphorylase_euk. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR21234. PTHR21234. 1 hit. PTHR21234:SF4. PTHR21234:SF4. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF01048. PNP_UDP_1. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| TIGRFAMs | TIGR01719. euk_UDPppase. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS01232. PNP_UDP_1. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| BindingDB | O95045. | ||||||||||||||||||||||||
| ChEMBL | CHEMBL2471. | ||||||||||||||||||||||||
| EvolutionaryTrace | O95045. | ||||||||||||||||||||||||
| GenomeRNAi | 151531. | ||||||||||||||||||||||||
| NextBio | 86721. | ||||||||||||||||||||||||
Entry information
| Entry name | UPP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O95045 Secondary accession number(s): B3KV87 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
