Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O94991

- SLIK5_HUMAN

UniProt

O94991 - SLIK5_HUMAN

Protein

SLIT and NTRK-like protein 5

Gene

SLITRK5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 117 (01 Oct 2014)
      Sequence version 2 (13 Apr 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Suppresses neurite outgrowth.By similarity

    GO - Biological processi

    1. adult behavior Source: Ensembl
    2. axonogenesis Source: Ensembl
    3. cardiovascular system development Source: Ensembl
    4. dendrite morphogenesis Source: Ensembl
    5. grooming behavior Source: Ensembl
    6. response to xenobiotic stimulus Source: Ensembl
    7. skin development Source: Ensembl
    8. striatum development Source: Ensembl
    9. synaptic transmission Source: Ensembl

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    SLIT and NTRK-like protein 5
    Alternative name(s):
    Leucine-rich repeat-containing protein 11
    Gene namesi
    Name:SLITRK5
    Synonyms:KIAA0918, LRRC11
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 13

    Organism-specific databases

    HGNCiHGNC:20295. SLITRK5.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. receptor complex Source: MGI

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134885524.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 4040Sequence AnalysisAdd
    BLAST
    Chaini41 – 958918SLIT and NTRK-like protein 5PRO_0000032681Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi103 – 1031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi644 – 6441N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiO94991.
    PRIDEiO94991.

    PTM databases

    PhosphoSiteiO94991.

    Expressioni

    Tissue specificityi

    Expressed predominantly in the cerebral cortex of the brain but also at low levels in the spinal cord and medulla.1 Publication

    Gene expression databases

    ArrayExpressiO94991.
    BgeeiO94991.
    CleanExiHS_SLITRK5.
    GenevestigatoriO94991.

    Organism-specific databases

    HPAiHPA013843.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000366283.

    Structurei

    3D structure databases

    ProteinModelPortaliO94991.
    SMRiO94991. Positions 48-283, 372-615.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini41 – 664624ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini686 – 958273CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei665 – 68521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati82 – 10322LRR 1Add
    BLAST
    Repeati106 – 12722LRR 2Add
    BLAST
    Repeati130 – 15122LRR 3Add
    BLAST
    Repeati154 – 17522LRR 4Add
    BLAST
    Repeati178 – 19922LRR 5Add
    BLAST
    Repeati201 – 22222LRR 6Add
    BLAST
    Domaini235 – 28652LRRCT 1Add
    BLAST
    Domaini365 – 40743LRRNTAdd
    BLAST
    Repeati410 – 43122LRR 7Add
    BLAST
    Repeati434 – 45522LRR 8Add
    BLAST
    Repeati458 – 47922LRR 9Add
    BLAST
    Repeati482 – 50322LRR 10Add
    BLAST
    Repeati506 – 52722LRR 11Add
    BLAST
    Repeati529 – 55022LRR 12Add
    BLAST
    Domaini563 – 61452LRRCT 2Add
    BLAST

    Sequence similaritiesi

    Belongs to the SLITRK family.Curated
    Contains 12 LRR (leucine-rich) repeats.Curated
    Contains 2 LRRCT domains.Curated
    Contains 1 LRRNT domain.Curated

    Keywords - Domaini

    Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG147171.
    HOGENOMiHOG000290667.
    HOVERGENiHBG056407.
    InParanoidiO94991.
    OMAiVICKAPK.
    OrthoDBiEOG7W9RT2.
    PhylomeDBiO94991.
    TreeFamiTF326378.

    Family and domain databases

    InterProiIPR000483. Cys-rich_flank_reg_C.
    IPR001611. Leu-rich_rpt.
    IPR003591. Leu-rich_rpt_typical-subtyp.
    IPR000372. LRR-contain_N.
    [Graphical view]
    PfamiPF00560. LRR_1. 1 hit.
    PF13855. LRR_8. 3 hits.
    [Graphical view]
    SMARTiSM00369. LRR_TYP. 4 hits.
    SM00082. LRRCT. 2 hits.
    SM00013. LRRNT. 1 hit.
    [Graphical view]
    PROSITEiPS51450. LRR. 11 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O94991-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MHTCCPPVTL EQDLHRKMHS WMLQTLAFAV TSLVLSCAET IDYYGEICDN    50
    ACPCEEKDGI LTVSCENRGI ISLSEISPPR FPIYHLLLSG NLLNRLYPNE 100
    FVNYTGASIL HLGSNVIQDI ETGAFHGLRG LRRLHLNNNK LELLRDDTFL 150
    GLENLEYLQV DYNYISVIEP NAFGKLHLLQ VLILNDNLLS SLPNNLFRFV 200
    PLTHLDLRGN RLKLLPYVGL LQHMDKVVEL QLEENPWNCS CELISLKDWL 250
    DSISYSALVG DVVCETPFRL HGRDLDEVSK QELCPRRLIS DYEMRPQTPL 300
    STTGYLHTTP ASVNSVATSS SAVYKPPLKP PKGTRQPNKP RVRPTSRQPS 350
    KDLGYSNYGP SIAYQTKSPV PLECPTACSC NLQISDLGLN VNCQERKIES 400
    IAELQPKPYN PKKMYLTENY IAVVRRTDFL EATGLDLLHL GNNRISMIQD 450
    RAFGDLTNLR RLYLNGNRIE RLSPELFYGL QSLQYLFLQY NLIREIQSGT 500
    FDPVPNLQLL FLNNNLLQAM PSGVFSGLTL LRLNLRSNHF TSLPVSGVLD 550
    QLKSLIQIDL HDNPWDCTCD IVGMKLWVEQ LKVGVLVDEV ICKAPKKFAE 600
    TDMRSIKSEL LCPDYSDVVV STPTPSSIQV PARTSAVTPA VRLNSTGAPA 650
    SLGAGGGASS VPLSVLILSL LLVFIMSVFV AAGLFVLVMK RRKKNQSDHT 700
    STNNSDVSSF NMQYSVYGGG GGTGGHPHAH VHHRGPALPK VKTPAGHVYE 750
    YIPHPLGHMC KNPIYRSREG NSVEDYKDLH ELKVTYSSNH HLQQQQQPPP 800
    PPQQPQQQPP PQLQLQPGEE ERRESHHLRS PAYSVSTIEP REDLLSPVQD 850
    ADRFYRGILE PDKHCSTTPA GNSLPEYPKF PCSPAAYTFS PNYDLRRPHQ 900
    YLHPGAGDSR LREPVLYSPP SAVFVEPNRN EYLELKAKLN VEPDYLEVLE 950
    KQTTFSQF 958
    Length:958
    Mass (Da):107,486
    Last modified:April 13, 2004 - v2
    Checksum:i69E71DC1EE3C568B
    GO
    Isoform 2 (identifier: O94991-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-31: MHTCCPPVTLEQDLHRKMHSWMLQTLAFAVT → MGAGKHREGGGGDPTSLNGCADLIQRRTEIS
         32-272: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:717
    Mass (Da):79,766
    Checksum:i63B31626796F01C4
    GO

    Sequence cautioni

    The sequence BAA74941.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3131MHTCC…AFAVT → MGAGKHREGGGGDPTSLNGC ADLIQRRTEIS in isoform 2. 1 PublicationVSP_056676Add
    BLAST
    Alternative sequencei32 – 272241Missing in isoform 2. 1 PublicationVSP_056677Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB020725 mRNA. Translation: BAA74941.1. Different initiation.
    AK024251 mRNA. Translation: BAG51280.1.
    AK299744 mRNA. Translation: BAG61637.1.
    AL603883 Genomic DNA. Translation: CAH73026.1.
    CH471085 Genomic DNA. Translation: EAX08917.1.
    BC098106 mRNA. Translation: AAH98106.1.
    BC103509 mRNA. Translation: AAI03510.1.
    CCDSiCCDS9465.1.
    RefSeqiNP_056382.1. NM_015567.1.
    XP_005254095.1. XM_005254038.2.
    XP_005254096.1. XM_005254039.1.
    UniGeneiHs.591208.

    Genome annotation databases

    EnsembliENST00000325089; ENSP00000366283; ENSG00000165300.
    ENST00000400028; ENSP00000442244; ENSG00000165300.
    GeneIDi26050.
    KEGGihsa:26050.
    UCSCiuc001vln.3. human.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB020725 mRNA. Translation: BAA74941.1 . Different initiation.
    AK024251 mRNA. Translation: BAG51280.1 .
    AK299744 mRNA. Translation: BAG61637.1 .
    AL603883 Genomic DNA. Translation: CAH73026.1 .
    CH471085 Genomic DNA. Translation: EAX08917.1 .
    BC098106 mRNA. Translation: AAH98106.1 .
    BC103509 mRNA. Translation: AAI03510.1 .
    CCDSi CCDS9465.1.
    RefSeqi NP_056382.1. NM_015567.1.
    XP_005254095.1. XM_005254038.2.
    XP_005254096.1. XM_005254039.1.
    UniGenei Hs.591208.

    3D structure databases

    ProteinModelPortali O94991.
    SMRi O94991. Positions 48-283, 372-615.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000366283.

    PTM databases

    PhosphoSitei O94991.

    Proteomic databases

    PaxDbi O94991.
    PRIDEi O94991.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000325089 ; ENSP00000366283 ; ENSG00000165300 .
    ENST00000400028 ; ENSP00000442244 ; ENSG00000165300 .
    GeneIDi 26050.
    KEGGi hsa:26050.
    UCSCi uc001vln.3. human.

    Organism-specific databases

    CTDi 26050.
    GeneCardsi GC13P088324.
    HGNCi HGNC:20295. SLITRK5.
    HPAi HPA013843.
    MIMi 609680. gene.
    neXtProti NX_O94991.
    PharmGKBi PA134885524.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG147171.
    HOGENOMi HOG000290667.
    HOVERGENi HBG056407.
    InParanoidi O94991.
    OMAi VICKAPK.
    OrthoDBi EOG7W9RT2.
    PhylomeDBi O94991.
    TreeFami TF326378.

    Miscellaneous databases

    GeneWikii SLITRK5.
    GenomeRNAii 26050.
    NextBioi 47908.
    PROi O94991.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O94991.
    Bgeei O94991.
    CleanExi HS_SLITRK5.
    Genevestigatori O94991.

    Family and domain databases

    InterProi IPR000483. Cys-rich_flank_reg_C.
    IPR001611. Leu-rich_rpt.
    IPR003591. Leu-rich_rpt_typical-subtyp.
    IPR000372. LRR-contain_N.
    [Graphical view ]
    Pfami PF00560. LRR_1. 1 hit.
    PF13855. LRR_8. 3 hits.
    [Graphical view ]
    SMARTi SM00369. LRR_TYP. 4 hits.
    SM00082. LRRCT. 2 hits.
    SM00013. LRRNT. 1 hit.
    [Graphical view ]
    PROSITEi PS51450. LRR. 11 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain.
    3. "The DNA sequence and analysis of human chromosome 13."
      Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
      Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. "Human SLITRK family genes: genomic organization and expression profiling in normal brain and brain tumor tissue."
      Aruga J., Yokota N., Mikoshiba K.
      Gene 315:87-94(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION, TISSUE SPECIFICITY.
      Tissue: Brain and Brain tumor.

    Entry informationi

    Entry nameiSLIK5_HUMAN
    AccessioniPrimary (citable) accession number: O94991
    Secondary accession number(s): B3KNB8, B4DSH5, Q5VT81
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 20, 2001
    Last sequence update: April 13, 2004
    Last modified: October 1, 2014
    This is version 117 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 13
      Human chromosome 13: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3