O94979 (SC31A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein transport protein Sec31A Alternative name(s): ABP125 ABP130 SEC31-like protein 1 SEC31-related protein A Web1-like protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1220 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules By similarity. Ref.1 |
| Subunit structure | COPII is composed of at least 5 proteins: the SEC23/24 complex, the SEC13/31 complex and SAR1. SEC13 and SEC31 make a 2:2 tetramer that forms the edge element of the COPII outer coat. The tetramer self-assembles in multiple copies to form the complete polyhedral cage. Interacts (via WD 8) with SEC13 By similarity. Interacts with PDCD6 in a calcium-dependent manner. Interacts with KLHL12. Ref.14 Ref.16 Ref.22 |
| Subcellular location | Cytoplasm By similarity. Cytoplasmic vesicle › COPII-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Endoplasmic reticulum membrane; Peripheral membrane protein By similarity. Note: Associates with membranes in a GTP-dependent manner By similarity. Ref.1 Ref.14 Ref.22 |
| Tissue specificity | |
| Post-translational modification | Monoubiquitinated by the BCR(KLHL12) E3 ubiquitin ligase complex, leading to regulate the size of COPII coats. |
| Involvement in disease | A chromosomal aberration involving SEC31A is associated with inflammatory myofibroblastic tumors (IMTs). Translocation t(2;4)(p23;q21) with ALK. |
| Sequence similarities | Belongs to the WD repeat SEC31 family. Contains 8 WD repeats. |
| Sequence caution | The sequence AAF28953.1 differs from that shown. Reason: Frameshift at positions 857 and 1079. The sequence AAF29012.1 differs from that shown. Reason: Frameshift at positions 922, 946, 1029 and 1080. The sequence CAI45995.1 differs from that shown. Reason: Erroneous termination at position 221. Translated as Trp. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PDCD6 | O75340 | 6 | EBI-1767898,EBI-352915 |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94979-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94979-2) The sequence of this isoform differs from the canonical sequence as follows: 974-988: Missing. | ||||||
| Isoform 3 (identifier: O94979-3) The sequence of this isoform differs from the canonical sequence as follows: 876-876: P → R 877-990: Missing. | ||||||
| Isoform 4 (identifier: O94979-4) The sequence of this isoform differs from the canonical sequence as follows: 504-542: Missing. | ||||||
| Isoform 5 (identifier: O94979-5) The sequence of this isoform differs from the canonical sequence as follows: 504-509: IALALN → VNFWES 510-1220: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: O94979-6) The sequence of this isoform differs from the canonical sequence as follows: 504-542: Missing. 876-876: P → R 877-990: Missing. | ||||||
| Isoform 7 (identifier: O94979-7) The sequence of this isoform differs from the canonical sequence as follows: 1-228: Missing. 229-260: MVLASEDDRLPVIQMWDLRFASSPLRVLENHA → MVKLVLLSIVLLKVTVPKLSNYLLQLDFMPIH 504-542: Missing. 834-834: H → HVRIAPTVTTWSNKTPTALPSHPPAASPSDTQ 974-988: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 8 (identifier: O94979-8) The sequence of this isoform differs from the canonical sequence as follows: 989-989: T → TENQSIQDQAPMLE | ||||||
| Isoform 9 (identifier: O94979-9) The sequence of this isoform differs from the canonical sequence as follows: 1-26: MKLKEVDRTAMQAWSPAQNHPIYLAT → MLGESDERCTNAGSGCRRSSP 974-988: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1220 | 1220 | Protein transport protein Sec31A | PRO_0000295147 | |||||
Regions | |||||||||
| Repeat | 4 – 47 | 44 | WD 1 | ||||||
| Repeat | 68 – 111 | 44 | WD 2 | ||||||
| Repeat | 120 – 160 | 41 | WD 3 | ||||||
| Repeat | 166 – 206 | 41 | WD 4 | ||||||
| Repeat | 209 – 254 | 46 | WD 5 | ||||||
| Repeat | 258 – 298 | 41 | WD 6 | ||||||
| Repeat | 301 – 342 | 42 | WD 7 | ||||||
| Repeat | 397 – 430 | 34 | WD 8; interaction with SEC13 By similarity | ||||||
| Region | 161 – 471 | 311 | Interaction with SEC13 | ||||||
| Region | 800 – 1113 | 314 | Interaction with PDCD6 | ||||||
| Compositional bias | 800 – 1091 | 292 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 527 | 1 | Phosphoserine Ref.13 Ref.21 | ||||||
| Modified residue | 532 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 799 | 1 | Phosphoserine Ref.17 Ref.19 Ref.21 | ||||||
| Modified residue | 1161 | 1 | Phosphothreonine Ref.19 | ||||||
| Modified residue | 1163 | 1 | Phosphoserine Ref.17 | ||||||
| Cross-link | 647 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.22 | |||||||
| Cross-link | 1217 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.22 | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 228 | 228 | Missing in isoform 7. | VSP_026742 | |||||
| Alternative sequence | 1 – 26 | 26 | MKLKE…IYLAT → MLGESDERCTNAGSGCRRSS P in isoform 9. | VSP_044602 | |||||
| Alternative sequence | 229 – 260 | 32 | MVLAS…LENHA → MVKLVLLSIVLLKVTVPKLS NYLLQLDFMPIH in isoform 7. | VSP_026743 | |||||
| Alternative sequence | 504 – 542 | 39 | Missing in isoform 4, isoform 6 and isoform 7. | VSP_026744 | |||||
| Alternative sequence | 504 – 509 | 6 | IALALN → VNFWES in isoform 5. | VSP_026745 | |||||
| Alternative sequence | 510 – 1220 | 711 | Missing in isoform 5. | VSP_026746 | |||||
| Alternative sequence | 834 | 1 | H → HVRIAPTVTTWSNKTPTALP SHPPAASPSDTQ in isoform 7. | VSP_026747 | |||||
| Alternative sequence | 876 | 1 | P → R in isoform 3 and isoform 6. | VSP_026748 | |||||
| Alternative sequence | 877 – 990 | 114 | Missing in isoform 3 and isoform 6. | VSP_026749 | |||||
| Alternative sequence | 974 – 988 | 15 | Missing in isoform 2, isoform 7 and isoform 9. | VSP_026750 | |||||
| Alternative sequence | 989 | 1 | T → TENQSIQDQAPMLE in isoform 8. | VSP_026751 | |||||
| Natural variant | 263 | 1 | I → V. Corresponds to variant rs34554214 [ dbSNP | Ensembl ]. | VAR_033225 | |||||
| Natural variant | 456 | 1 | N → K. Corresponds to variant rs3797036 [ dbSNP | Ensembl ]. | VAR_053414 | |||||
| Natural variant | 841 | 1 | P → L. Corresponds to variant rs35579207 [ dbSNP | Ensembl ]. | VAR_033226 | |||||
| Natural variant | 1055 | 1 | P → T. Corresponds to variant rs35739017 [ dbSNP | Ensembl ]. | VAR_033227 | |||||
Experimental info | |||||||||
| Mutagenesis | 647 | 1 | K → R: Does not abolish monoubiquitination by the BCR(KLHL12) E3 ubiquitin ligase complex, revealing flexibility of ubiquitination sites; when associated with R-1217. Ref.22 | ||||||
| Mutagenesis | 1217 | 1 | K → R: Does not abolish monoubiquitination by the BCR(KLHL12) E3 ubiquitin ligase complex, revealing flexibility of ubiquitination sites; when associated with R-647. Ref.22 | ||||||
| Sequence conflict | 200 | 1 | K → E in BAA84923. Ref.2 | ||||||
| Sequence conflict | 284 | 1 | K → R in BAC86336. Ref.5 | ||||||
| Sequence conflict | 854 | 1 | A → S in BAA84923. Ref.2 | ||||||
| Sequence conflict | 854 | 1 | A → S in BAA84924. Ref.2 | ||||||
| Sequence conflict | 1007 | 1 | K → R in BAG58628. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mammalian homologues of yeast sec31p. An ubiquitously expressed form is localized to endoplasmic reticulum (ER) exit sites and is essential for ER-Golgi transport." Tang B.L., Zhang T., Low D.Y.H., Wong E.T., Horstmann H., Hong W. J. Biol. Chem. 275:13597-13604(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Pancreas. |
| [2] | "The yeast web1-like human protein that has WD repeat domain." Noguchi J., Shibata M. Submitted (OCT-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4). Tissue: Spleen. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | Ohara O., Suyama M., Kikuno R., Nagase T., Ishikawa K. Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 7 AND 9). Tissue: Hippocampus and Testis. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: Uterine endothelium and Uterus. |
| [7] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 5). Tissue: Brain and PNS. |
| [10] | "SEC31 splicing variant." Yang Y., Trejo J. Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 599-1220 (ISOFORMS 3/6). Tissue: Placenta. |
| [11] | "Human partial CDS from CD34+ stem cells." Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z. Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 852-1220 (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 899-1220 (ISOFORM 1). Tissue: Blood. |
| [12] | "Identification of the putative mammalian orthologue of Sec31P, a component of the COPII coat." Shugrue C.A., Kolen E.R., Peters H., Czernik A., Kaiser C., Matovcik L., Hubbard A.L., Gorelick F. J. Cell Sci. 112:4547-4556(1999) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [13] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-527 AND SER-532, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "The Ca2+-binding protein ALG-2 is recruited to endoplasmic reticulum exit sites by Sec31A and stabilizes the localization of Sec31A." Yamasaki A., Tani K., Yamamoto A., Kitamura N., Komada M. Mol. Biol. Cell 17:4876-4887(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, INTERACTION WITH PDCD6 AND SEC13, SUBCELLULAR LOCATION. |
| [15] | "Fusion of the SEC31L1 and ALK genes in an inflammatory myofibroblastic tumor." Panagopoulos I., Nilsson T., Domanski H.A., Isaksson M., Lindblom P., Mertens F., Mandahl N. Int. J. Cancer 118:1181-1186(2006) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH ALK. |
| [16] | "ALG-2 directly binds Sec31A and localizes at endoplasmic reticulum exit sites in a Ca2+-dependent manner." Shibata H., Suzuki H., Yoshida H., Maki M. Biochem. Biophys. Res. Commun. 353:756-763(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PDCD6. |
| [17] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-799 AND SER-1163, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [19] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-799 AND THR-1161, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [20] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [21] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-527 AND SER-799, MASS SPECTROMETRY. |
| [22] | "Ubiquitin-dependent regulation of COPII coat size and function." Jin L., Pahuja K.B., Wickliffe K.E., Gorur A., Baumgartel C., Schekman R., Rape M. Nature 482:495-500(2012) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, UBIQUITINATION AT LYS-647 AND LYS-1217, MUTAGENESIS OF LYS-647 AND LYS-1217, INTERACTION WITH KLHL12. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF139184 mRNA. Translation: AAF67836.1. AB018358 mRNA. Translation: BAA84923.1. AB018359 mRNA. Translation: BAA84924.1. AB020712 mRNA. Translation: BAA74928.2. AK125897 mRNA. Translation: BAC86336.1. AK295810 mRNA. Translation: BAG58628.1. AL049463 mRNA. Translation: CAH56418.1. CR933696 mRNA. Translation: CAI45995.1. Sequence problems. AC021105 Genomic DNA. No translation available. AC108469 Genomic DNA. No translation available. CH471057 Genomic DNA. Translation: EAX05908.1. BC047883 mRNA. Translation: AAH47883.1. BC084583 mRNA. Translation: AAH84583.1. BC117221 mRNA. Translation: AAI17222.1. BC143489 mRNA. Translation: AAI43490.1. BC143491 mRNA. Translation: AAI43492.1. AY137583 mRNA. Translation: AAN15221.1. AF161393 mRNA. Translation: AAF28953.1. Frameshift. AF161452 mRNA. Translation: AAF29012.1. Frameshift. |
| IPI | IPI00305152. IPI00445429. IPI00515103. IPI00746182. IPI00795507. IPI00853220. IPI00853290. IPI00965105. IPI00966405. |
| RefSeq | NP_001070674.1. NM_001077206.2. NP_001070675.1. NM_001077207.2. NP_001070676.1. NM_001077208.2. NP_001177978.1. NM_001191049.1. NP_055748.2. NM_014933.3. NP_057295.2. NM_016211.3. |
| UniGene | Hs.370024. |
3D structure databases | |
| ProteinModelPortal | O94979. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-40438N. |
| IntAct | O94979. 29 interactions. |
| MINT | MINT-3002555. |
PTM databases | |
| PhosphoSite | O94979. |
Proteomic databases | |
| PaxDb | O94979. |
| PRIDE | O94979. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000311785; ENSP00000309070; ENSG00000138674. ENST00000326950; ENSP00000325087; ENSG00000138674. ENST00000348405; ENSP00000337602; ENSG00000138674. ENST00000355196; ENSP00000347329; ENSG00000138674. ENST00000395310; ENSP00000378721; ENSG00000138674. ENST00000432794; ENSP00000407944; ENSG00000138674. ENST00000443462; ENSP00000408027; ENSG00000138674. ENST00000448323; ENSP00000400926; ENSG00000138674. ENST00000500777; ENSP00000421464; ENSG00000138674. ENST00000508502; ENSP00000424635; ENSG00000138674. ENST00000509142; ENSP00000426569; ENSG00000138674. ENST00000513858; ENSP00000426886; ENSG00000138674. |
| GeneID | 22872. |
| KEGG | hsa:22872. |
| UCSC | uc003hne.3. human. uc003hnf.3. human. uc003hng.3. human. uc003hni.3. human. uc003hnk.3. human. uc003hnl.3. human. uc003hno.3. human. uc011ccm.2. human. |
Organism-specific databases | |
| CTD | 22872. |
| GeneCards | GC04M083739. |
| HGNC | HGNC:17052. SEC31A. |
| HPA | HPA005457. |
| MIM | 610257. gene. |
| neXtProt | NX_O94979. |
| PharmGKB | PA162402737. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG248389. |
| HOVERGEN | HBG055626. |
| InParanoid | O94979. |
| KO | K14005. |
| OrthoDB | EOG4WDDB3. |
| PhylomeDB | O94979. |
Enzyme and pathway databases | |
| Reactome | REACT_11123. Membrane Trafficking. REACT_116125. Disease. REACT_17015. Metabolism of proteins. REACT_6900. Immune System. |
| SignaLink | O94979. |
Gene expression databases | |
| ArrayExpress | O94979. |
| Bgee | O94979. |
| Genevestigator | O94979. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 1 hit. |
| InterPro | IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR017986. WD40_repeat_dom. [Graphical view] |
| Pfam | PF00400. WD40. 1 hit. [Graphical view] |
| SMART | SM00320. WD40. 6 hits. [Graphical view] |
| SUPFAM | SSF50978. WD40_like. 1 hit. |
| PROSITE | PS00678. WD_REPEATS_1. False negative. PS50082. WD_REPEATS_2. 1 hit. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SEC31A. human. |
| GenomeRNAi | 22872. |
| NextBio | 43407. |
| SOURCE | Search... |
Entry information
| Entry name | SC31A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94979 Secondary accession number(s): B4DIW6 Q9UM06 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
