Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O94929

- ABLM3_HUMAN

UniProt

O94929 - ABLM3_HUMAN

Protein

Actin-binding LIM protein 3

Gene

ABLIM3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 125 (01 Oct 2014)
      Sequence version 3 (07 Dec 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.1 Publication

    GO - Molecular functioni

    1. zinc ion binding Source: InterPro

    GO - Biological processi

    1. actin cytoskeleton organization Source: InterPro
    2. axon guidance Source: Reactome
    3. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
    4. transcription, DNA-templated Source: InterPro

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_22351. DCC mediated attractive signaling.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Actin-binding LIM protein 3
    Short name:
    abLIM-3
    Alternative name(s):
    Actin-binding LIM protein family member 3
    Gene namesi
    Name:ABLIM3
    Synonyms:KIAA0843
    ORF Names:HMFN1661
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:29132. ABLIM3.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134962761.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 683683Actin-binding LIM protein 3PRO_0000075702Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine1 Publication
    Modified residuei277 – 2771PhosphoserineBy similarity
    Modified residuei280 – 2801PhosphoserineBy similarity
    Modified residuei503 – 5031Phosphoserine2 Publications
    Modified residuei504 – 5041Phosphoserine2 Publications
    Modified residuei543 – 5431PhosphothreonineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiO94929.
    PaxDbiO94929.
    PRIDEiO94929.

    PTM databases

    PhosphoSiteiO94929.

    Expressioni

    Tissue specificityi

    Expressed predominantly in heart and brain.1 Publication

    Gene expression databases

    ArrayExpressiO94929.
    BgeeiO94929.
    CleanExiHS_ABLIM3.
    GenevestigatoriO94929.

    Organism-specific databases

    HPAiHPA003245.

    Interactioni

    Subunit structurei

    Directly interacts with F-actin and ABRA.1 Publication

    Protein-protein interaction databases

    BioGridi116552. 3 interactions.
    IntActiO94929. 4 interactions.
    MINTiMINT-4657493.
    STRINGi9606.ENSP00000310309.

    Structurei

    Secondary structure

    1
    683
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni152 – 1543
    Beta strandi159 – 1613
    Beta strandi164 – 1663
    Beta strandi169 – 1713
    Turni173 – 1753
    Beta strandi179 – 1813
    Beta strandi190 – 1923
    Beta strandi195 – 1973
    Helixi201 – 2055
    Turni623 – 6264
    Turni630 – 6334
    Turni642 – 6443
    Helixi645 – 6484
    Helixi653 – 6586
    Helixi662 – 6654
    Helixi670 – 67910

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1UJSNMR-A609-683[»]
    2DJ7NMR-A141-207[»]
    ProteinModelPortaliO94929.
    SMRiO94929. Positions 6-268, 607-683.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO94929.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini21 – 8060LIM zinc-binding 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini80 – 14061LIM zinc-binding 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini149 – 20860LIM zinc-binding 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini208 – 26861LIM zinc-binding 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini615 – 68369HPPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 HP (headpiece) domain.PROSITE-ProRule annotation
    Contains 4 LIM zinc-binding domains.PROSITE-ProRule annotation

    Keywords - Domaini

    LIM domain, Repeat

    Phylogenomic databases

    eggNOGiNOG302299.
    HOGENOMiHOG000285997.
    HOVERGENiHBG031499.
    InParanoidiO94929.
    KOiK07520.
    OMAiDPYYASE.
    OrthoDBiEOG71CFKF.
    PhylomeDBiO94929.
    TreeFamiTF318042.

    Family and domain databases

    Gene3Di1.10.950.10. 1 hit.
    2.10.110.10. 4 hits.
    InterProiIPR028449. ABLIM3.
    IPR003128. Villin_headpiece.
    IPR001781. Znf_LIM.
    [Graphical view]
    PANTHERiPTHR24213:SF0. PTHR24213:SF0. 1 hit.
    PfamiPF00412. LIM. 4 hits.
    PF02209. VHP. 1 hit.
    [Graphical view]
    SMARTiSM00132. LIM. 4 hits.
    SM00153. VHP. 1 hit.
    [Graphical view]
    SUPFAMiSSF47050. SSF47050. 1 hit.
    PROSITEiPS51089. HP. 1 hit.
    PS00478. LIM_DOMAIN_1. 4 hits.
    PS50023. LIM_DOMAIN_2. 4 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O94929-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNTSIPYQQN PYNPRGSSNV IQCYRCGDTC KGEVVRVHNN HFHIRCFTCQ    50
    VCGCGLAQSG FFFKNQEYIC TQDYQQLYGT RCDSCRDFIT GEVISALGRT 100
    YHPKCFVCSL CRKPFPIGDK VTFSGKECVC QTCSQSMASS KPIKIRGPSH 150
    CAGCKEEIKH GQSLLALDKQ WHVSCFKCQT CSVILTGEYI SKDGVPYCES 200
    DYHAQFGIKC ETCDRYISGR VLEAGGKHYH PTCARCVRCH QMFTEGEEMY 250
    LTGSEVWHPI CKQAARAEKK LKHRRTSETS ISPPGSSIGS PNRVICAKVD 300
    NEILNYKDLA ALPKVKSIYE VQRPDLISYE PHSRYMSDEM LERCGYGESL 350
    GTLSPYSQDI YENLDLRQRR ASSPGYIDSP TYSRQGMSPT FSRSPHHYYR 400
    SGPESGRSSP YHSQLDVRSS TPTSYQAPKH FHIPAGDSNI YRKPPIYKRH 450
    GDLSTATKSK TSEDISQTSK YSPIYSPDPY YASESEYWTY HGSPKVPRAR 500
    RFSSGGEEDD FDRSMHKLQS GIGRLILKEE MKARSSSYAD PWTPPRSSTS 550
    SREALHTAGY EMSLNGSPRS HYLADSDPLI SKSASLPAYR RNGLHRTPSA 600
    DLFHYDSMNA VNWGMREYKI YPYELLLVTT RGRNRLPKDV DRTRLERHLS 650
    QEEFYQVFGM TISEFDRLAL WKRNELKKQA RLF 683
    Length:683
    Mass (Da):77,802
    Last modified:December 7, 2004 - v3
    Checksum:i0392DBD9065EE08A
    GO
    Isoform 2 (identifier: O94929-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         297-358: Missing.
         402-450: Missing.
         647-683: RHLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF → GNFWKSGCL

    Note: No experimental confirmation available.

    Show »
    Length:544
    Mass (Da):61,570
    Checksum:iE6A19F001BF02176
    GO
    Isoform 3 (identifier: O94929-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         297-358: Missing.
         402-434: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:588
    Mass (Da):67,073
    Checksum:i858F0D8EA50B1A57
    GO
    Isoform 4 (identifier: O94929-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-514: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:169
    Mass (Da):19,695
    Checksum:i18F1F045422E1552
    GO

    Sequence cautioni

    The sequence BAA74866.2 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti227 – 2271K → R in BAF82425. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti125 – 1251G → D.
    Corresponds to variant rs35907283 [ dbSNP | Ensembl ].
    VAR_050143

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 514514Missing in isoform 4. 1 PublicationVSP_012126Add
    BLAST
    Alternative sequencei297 – 35862Missing in isoform 2 and isoform 3. 3 PublicationsVSP_012127Add
    BLAST
    Alternative sequencei402 – 45049Missing in isoform 2. 1 PublicationVSP_012128Add
    BLAST
    Alternative sequencei402 – 43433Missing in isoform 3. 2 PublicationsVSP_012129Add
    BLAST
    Alternative sequencei647 – 68337RHLSQ…QARLF → GNFWKSGCL in isoform 2. 1 PublicationVSP_012130Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ413174 mRNA. Translation: ABD83327.1.
    AB020650 mRNA. Translation: BAA74866.2. Different initiation.
    AK289736 mRNA. Translation: BAF82425.1.
    AB075881 mRNA. Translation: BAD38663.1.
    BC001665 mRNA. Translation: AAH01665.1.
    AL833021 mRNA. Translation: CAH56270.1.
    CCDSiCCDS4294.1. [O94929-1]
    RefSeqiNP_055760.1. NM_014945.2. [O94929-1]
    XP_005268449.1. XM_005268392.1.
    XP_005268452.1. XM_005268395.1. [O94929-3]
    XP_006714826.1. XM_006714763.1. [O94929-1]
    UniGeneiHs.49688.

    Genome annotation databases

    EnsembliENST00000309868; ENSP00000310309; ENSG00000173210. [O94929-1]
    ENST00000326685; ENSP00000315841; ENSG00000173210. [O94929-3]
    ENST00000356541; ENSP00000348938; ENSG00000173210. [O94929-2]
    ENST00000504238; ENSP00000421183; ENSG00000173210. [O94929-2]
    ENST00000506113; ENSP00000425394; ENSG00000173210. [O94929-1]
    ENST00000508983; ENSP00000420855; ENSG00000173210.
    ENST00000517451; ENSP00000430150; ENSG00000173210. [O94929-4]
    GeneIDi22885.
    KEGGihsa:22885.
    UCSCiuc003lpy.2. human. [O94929-1]
    uc003lqa.1. human. [O94929-2]
    uc003lqd.1. human. [O94929-3]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ413174 mRNA. Translation: ABD83327.1 .
    AB020650 mRNA. Translation: BAA74866.2 . Different initiation.
    AK289736 mRNA. Translation: BAF82425.1 .
    AB075881 mRNA. Translation: BAD38663.1 .
    BC001665 mRNA. Translation: AAH01665.1 .
    AL833021 mRNA. Translation: CAH56270.1 .
    CCDSi CCDS4294.1. [O94929-1 ]
    RefSeqi NP_055760.1. NM_014945.2. [O94929-1 ]
    XP_005268449.1. XM_005268392.1.
    XP_005268452.1. XM_005268395.1. [O94929-3 ]
    XP_006714826.1. XM_006714763.1. [O94929-1 ]
    UniGenei Hs.49688.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1UJS NMR - A 609-683 [» ]
    2DJ7 NMR - A 141-207 [» ]
    ProteinModelPortali O94929.
    SMRi O94929. Positions 6-268, 607-683.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116552. 3 interactions.
    IntActi O94929. 4 interactions.
    MINTi MINT-4657493.
    STRINGi 9606.ENSP00000310309.

    PTM databases

    PhosphoSitei O94929.

    Proteomic databases

    MaxQBi O94929.
    PaxDbi O94929.
    PRIDEi O94929.

    Protocols and materials databases

    DNASUi 22885.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000309868 ; ENSP00000310309 ; ENSG00000173210 . [O94929-1 ]
    ENST00000326685 ; ENSP00000315841 ; ENSG00000173210 . [O94929-3 ]
    ENST00000356541 ; ENSP00000348938 ; ENSG00000173210 . [O94929-2 ]
    ENST00000504238 ; ENSP00000421183 ; ENSG00000173210 . [O94929-2 ]
    ENST00000506113 ; ENSP00000425394 ; ENSG00000173210 . [O94929-1 ]
    ENST00000508983 ; ENSP00000420855 ; ENSG00000173210 .
    ENST00000517451 ; ENSP00000430150 ; ENSG00000173210 . [O94929-4 ]
    GeneIDi 22885.
    KEGGi hsa:22885.
    UCSCi uc003lpy.2. human. [O94929-1 ]
    uc003lqa.1. human. [O94929-2 ]
    uc003lqd.1. human. [O94929-3 ]

    Organism-specific databases

    CTDi 22885.
    GeneCardsi GC05P148501.
    HGNCi HGNC:29132. ABLIM3.
    HPAi HPA003245.
    MIMi 611305. gene.
    neXtProti NX_O94929.
    PharmGKBi PA134962761.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG302299.
    HOGENOMi HOG000285997.
    HOVERGENi HBG031499.
    InParanoidi O94929.
    KOi K07520.
    OMAi DPYYASE.
    OrthoDBi EOG71CFKF.
    PhylomeDBi O94929.
    TreeFami TF318042.

    Enzyme and pathway databases

    Reactomei REACT_22351. DCC mediated attractive signaling.

    Miscellaneous databases

    EvolutionaryTracei O94929.
    GeneWikii ABLIM3.
    GenomeRNAii 22885.
    NextBioi 43475.
    PROi O94929.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O94929.
    Bgeei O94929.
    CleanExi HS_ABLIM3.
    Genevestigatori O94929.

    Family and domain databases

    Gene3Di 1.10.950.10. 1 hit.
    2.10.110.10. 4 hits.
    InterProi IPR028449. ABLIM3.
    IPR003128. Villin_headpiece.
    IPR001781. Znf_LIM.
    [Graphical view ]
    PANTHERi PTHR24213:SF0. PTHR24213:SF0. 1 hit.
    Pfami PF00412. LIM. 4 hits.
    PF02209. VHP. 1 hit.
    [Graphical view ]
    SMARTi SM00132. LIM. 4 hits.
    SM00153. VHP. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47050. SSF47050. 1 hit.
    PROSITEi PS51089. HP. 1 hit.
    PS00478. LIM_DOMAIN_1. 4 hits.
    PS50023. LIM_DOMAIN_2. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Two novel members of the ABLIM protein family, ABLIM-2 and -3, associate with STARS and directly bind F-actin."
      Barrientos T., Frank D., Kuwahara K., Bezprozvannaya S., Pipes G.C.T., Bassel-Duby R., Richardson J.A., Katus H.A., Olson E.N., Frey N.
      J. Biol. Chem. 282:8393-8403(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH F-ACTIN AND ABRA.
      Tissue: Heart.
    2. "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
      Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
      Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Hepatoblastoma.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Colon.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 117-683 (ISOFORM 3).
      Tissue: Stomach.
    7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-503 AND SER-504, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Platelet.
    9. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
      Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
      Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-503 AND SER-504, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    10. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Solution structure of the villin headpiece domain of human actin-binding LIM protein homologue (KIAA0843 protein)."
      RIKEN structural genomics initiative (RSGI)
      Submitted (FEB-2004) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 610-683.

    Entry informationi

    Entry nameiABLM3_HUMAN
    AccessioniPrimary (citable) accession number: O94929
    Secondary accession number(s): A8K121
    , Q19VH3, Q658S1, Q68CI5, Q9BV32
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 7, 2004
    Last sequence update: December 7, 2004
    Last modified: October 1, 2014
    This is version 125 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3