O94929 (ABLM3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Actin-binding LIM protein 3 Short name=abLIM-3 Alternative name(s): Actin-binding LIM protein family member 3 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 683 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity. Ref.1 |
| Subunit structure | Directly interacts with F-actin and ABRA. Ref.1 |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Expressed predominantly in heart and brain. Ref.1 |
| Sequence similarities | Contains 1 HP (headpiece) domain. Contains 4 LIM zinc-binding domains. |
| Sequence caution | The sequence BAA74866.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | LIM domain Repeat |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | axon guidance Traceable author statement. Source: Reactome cytoskeleton organizationInferred from electronic annotation. Source: InterPro positive regulation of transcription from RNA polymerase II promoterInferred from electronic annotation. Source: Compara |
| Cellular_component | cytoplasm Non-traceable author statement. Source: UniProtKB |
| Molecular_function | zinc ion binding Non-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94929-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94929-2) The sequence of this isoform differs from the canonical sequence as follows: 297-358: Missing. 402-450: Missing. 647-683: RHLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF → GNFWKSGCL | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O94929-3) The sequence of this isoform differs from the canonical sequence as follows: 297-358: Missing. 402-434: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O94929-4) The sequence of this isoform differs from the canonical sequence as follows: 1-514: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 683 | 683 | Actin-binding LIM protein 3 | PRO_0000075702 | ||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||
| Domain | 21 – 80 | 60 | LIM zinc-binding 1 | |||||||||||||||||||||||||||||||||||||
| Domain | 80 – 140 | 61 | LIM zinc-binding 2 | |||||||||||||||||||||||||||||||||||||
| Domain | 149 – 208 | 60 | LIM zinc-binding 3 | |||||||||||||||||||||||||||||||||||||
| Domain | 208 – 268 | 61 | LIM zinc-binding 4 | |||||||||||||||||||||||||||||||||||||
| Domain | 615 – 683 | 69 | HP | |||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 277 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||
| Modified residue | 280 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||
| Modified residue | 282 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||
| Modified residue | 373 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||
| Modified residue | 503 | 1 | Phosphoserine Ref.7 Ref.9 | |||||||||||||||||||||||||||||||||||||
| Modified residue | 504 | 1 | Phosphoserine Ref.7 Ref.9 | |||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 514 | 514 | Missing in isoform 4. | VSP_012126 | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 297 – 358 | 62 | Missing in isoform 2 and isoform 3. | VSP_012127 | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 402 – 450 | 49 | Missing in isoform 2. | VSP_012128 | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 402 – 434 | 33 | Missing in isoform 3. | VSP_012129 | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 647 – 683 | 37 | RHLSQ…QARLF → GNFWKSGCL in isoform 2. | VSP_012130 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 125 | 1 | G → D. Corresponds to variant rs35907283 [ dbSNP | Ensembl ]. | VAR_050143 | ||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 227 | 1 | K → R in BAF82425. Ref.3 | |||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||
| Turn | 152 – 154 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 159 – 161 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 164 – 166 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 169 – 171 | 3 | ||||||||||||||||||||||||||||||||||||||
| Turn | 173 – 175 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 179 – 181 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 190 – 192 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 195 – 197 | 3 | ||||||||||||||||||||||||||||||||||||||
| Helix | 201 – 205 | 5 | ||||||||||||||||||||||||||||||||||||||
| Turn | 623 – 626 | 4 | ||||||||||||||||||||||||||||||||||||||
| Turn | 630 – 633 | 4 | ||||||||||||||||||||||||||||||||||||||
| Turn | 642 – 644 | 3 | ||||||||||||||||||||||||||||||||||||||
| Helix | 645 – 648 | 4 | ||||||||||||||||||||||||||||||||||||||
| Helix | 653 – 658 | 6 | ||||||||||||||||||||||||||||||||||||||
| Helix | 662 – 665 | 4 | ||||||||||||||||||||||||||||||||||||||
| Helix | 670 – 679 | 10 | ||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Two novel members of the ABLIM protein family, ABLIM-2 and -3, associate with STARS and directly bind F-actin." Barrientos T., Frank D., Kuwahara K., Bezprozvannaya S., Pipes G.C.T., Bassel-Duby R., Richardson J.A., Katus H.A., Olson E.N., Frey N. J. Biol. Chem. 282:8393-8403(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH F-ACTIN AND ABRA. Tissue: Heart. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas." Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A. Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Hepatoblastoma. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Colon. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 117-683 (ISOFORM 3). Tissue: Stomach. |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-503 AND SER-504, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Platelet. |
| [9] | "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-503 AND SER-504, MASS SPECTROMETRY. Tissue: Liver. |
| [10] | "Solution structure of the villin headpiece domain of human actin-binding LIM protein homologue (KIAA0843 protein)." RIKEN structural genomics initiative (RSGI) Submitted (FEB-2004) to the PDB data bank Cited for: STRUCTURE BY NMR OF 610-683. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | DQ413174 mRNA. Translation: ABD83327.1. AB020650 mRNA. Translation: BAA74866.2. Different initiation. AK289736 mRNA. Translation: BAF82425.1. AB075881 mRNA. Translation: BAD38663.1. BC001665 mRNA. Translation: AAH01665.1. AL833021 mRNA. Translation: CAH56270.1. | ||||||||||||||||||
| IPI | IPI00185892. IPI00477229. IPI00478204. IPI00478567. | ||||||||||||||||||
| RefSeq | NP_055760.1. NM_014945.2. | ||||||||||||||||||
| UniGene | Hs.49688. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | O94929. | ||||||||||||||||||
| SMR | O94929. Positions 34-268, 607-683. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | O94929. 3 interactions. | ||||||||||||||||||
| STRING | 9606.ENSP00000310309. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | O94929. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | O94929. | ||||||||||||||||||
| PRIDE | O94929. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 22885. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000309868; ENSP00000310309; ENSG00000173210. ENST00000326685; ENSP00000315841; ENSG00000173210. ENST00000356541; ENSP00000348938; ENSG00000173210. ENST00000504238; ENSP00000421183; ENSG00000173210. ENST00000506113; ENSP00000425394; ENSG00000173210. ENST00000508983; ENSP00000420855; ENSG00000173210. ENST00000517451; ENSP00000430150; ENSG00000173210. | ||||||||||||||||||
| GeneID | 22885. | ||||||||||||||||||
| KEGG | hsa:22885. | ||||||||||||||||||
| UCSC | uc003lpy.2. human. uc003lqa.1. human. uc003lqd.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 22885. | ||||||||||||||||||
| GeneCards | GC05P148501. | ||||||||||||||||||
| HGNC | HGNC:29132. ABLIM3. | ||||||||||||||||||
| HPA | HPA003245. | ||||||||||||||||||
| MIM | 611305. gene. | ||||||||||||||||||
| neXtProt | NX_O94929. | ||||||||||||||||||
| PharmGKB | PA134962761. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG302299. | ||||||||||||||||||
| HOGENOM | HOG000285997. | ||||||||||||||||||
| HOVERGEN | HBG031499. | ||||||||||||||||||
| InParanoid | O94929. | ||||||||||||||||||
| KO | K07520. | ||||||||||||||||||
| OMA | DPYYASE. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O94929. | ||||||||||||||||||
| Bgee | O94929. | ||||||||||||||||||
| CleanEx | HS_ABLIM3. | ||||||||||||||||||
| Genevestigator | O94929. | ||||||||||||||||||
| GermOnline | ENSG00000173210. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.10.950.10. 1 hit. 2.10.110.10. 4 hits. | ||||||||||||||||||
| InterPro | IPR003128. Villin_headpiece. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||||||||
| Pfam | PF00412. LIM. 4 hits. PF02209. VHP. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00132. LIM. 4 hits. SM00153. VHP. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF47050. VHP. 1 hit. | ||||||||||||||||||
| PROSITE | PS51089. HP. 1 hit. PS00478. LIM_DOMAIN_1. 4 hits. PS50023. LIM_DOMAIN_2. 4 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | O94929. | ||||||||||||||||||
| GenomeRNAi | 22885. | ||||||||||||||||||
| NextBio | 43475. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | ABLM3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94929 Secondary accession number(s): A8K121 Q9BV32 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
