SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O94929

- ABLM3_HUMAN

UniProt

O94929 - ABLM3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Actin-binding LIM protein 3
Gene
ABLIM3, KIAA0843, HMFN1661
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.1 Publication

GO - Molecular functioni

  1. zinc ion binding Source: InterPro

GO - Biological processi

  1. actin cytoskeleton organization Source: InterPro
  2. axon guidance Source: Reactome
  3. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  4. transcription, DNA-templated Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_22351. DCC mediated attractive signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Actin-binding LIM protein 3
Short name:
abLIM-3
Alternative name(s):
Actin-binding LIM protein family member 3
Gene namesi
Name:ABLIM3
Synonyms:KIAA0843
ORF Names:HMFN1661
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:29132. ABLIM3.

Subcellular locationi

Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134962761.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 683683Actin-binding LIM protein 3
PRO_0000075702Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine1 Publication
Modified residuei277 – 2771Phosphoserine By similarity
Modified residuei280 – 2801Phosphoserine By similarity
Modified residuei503 – 5031Phosphoserine2 Publications
Modified residuei504 – 5041Phosphoserine2 Publications
Modified residuei543 – 5431Phosphothreonine By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiO94929.
PaxDbiO94929.
PRIDEiO94929.

PTM databases

PhosphoSiteiO94929.

Expressioni

Tissue specificityi

Expressed predominantly in heart and brain.1 Publication

Gene expression databases

ArrayExpressiO94929.
BgeeiO94929.
CleanExiHS_ABLIM3.
GenevestigatoriO94929.

Organism-specific databases

HPAiHPA003245.

Interactioni

Subunit structurei

Directly interacts with F-actin and ABRA.1 Publication

Protein-protein interaction databases

BioGridi116552. 3 interactions.
IntActiO94929. 4 interactions.
MINTiMINT-4657493.
STRINGi9606.ENSP00000310309.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni152 – 1543
Beta strandi159 – 1613
Beta strandi164 – 1663
Beta strandi169 – 1713
Turni173 – 1753
Beta strandi179 – 1813
Beta strandi190 – 1923
Beta strandi195 – 1973
Helixi201 – 2055
Turni623 – 6264
Turni630 – 6334
Turni642 – 6443
Helixi645 – 6484
Helixi653 – 6586
Helixi662 – 6654
Helixi670 – 67910

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1UJSNMR-A609-683[»]
2DJ7NMR-A141-207[»]
ProteinModelPortaliO94929.
SMRiO94929. Positions 6-268, 607-683.

Miscellaneous databases

EvolutionaryTraceiO94929.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini21 – 8060LIM zinc-binding 1
Add
BLAST
Domaini80 – 14061LIM zinc-binding 2
Add
BLAST
Domaini149 – 20860LIM zinc-binding 3
Add
BLAST
Domaini208 – 26861LIM zinc-binding 4
Add
BLAST
Domaini615 – 68369HP
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiNOG302299.
HOGENOMiHOG000285997.
HOVERGENiHBG031499.
InParanoidiO94929.
KOiK07520.
OMAiDPYYASE.
OrthoDBiEOG71CFKF.
PhylomeDBiO94929.
TreeFamiTF318042.

Family and domain databases

Gene3Di1.10.950.10. 1 hit.
2.10.110.10. 4 hits.
InterProiIPR028449. ABLIM3.
IPR003128. Villin_headpiece.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR24213:SF0. PTHR24213:SF0. 1 hit.
PfamiPF00412. LIM. 4 hits.
PF02209. VHP. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 4 hits.
SM00153. VHP. 1 hit.
[Graphical view]
SUPFAMiSSF47050. SSF47050. 1 hit.
PROSITEiPS51089. HP. 1 hit.
PS00478. LIM_DOMAIN_1. 4 hits.
PS50023. LIM_DOMAIN_2. 4 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O94929-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MNTSIPYQQN PYNPRGSSNV IQCYRCGDTC KGEVVRVHNN HFHIRCFTCQ    50
VCGCGLAQSG FFFKNQEYIC TQDYQQLYGT RCDSCRDFIT GEVISALGRT 100
YHPKCFVCSL CRKPFPIGDK VTFSGKECVC QTCSQSMASS KPIKIRGPSH 150
CAGCKEEIKH GQSLLALDKQ WHVSCFKCQT CSVILTGEYI SKDGVPYCES 200
DYHAQFGIKC ETCDRYISGR VLEAGGKHYH PTCARCVRCH QMFTEGEEMY 250
LTGSEVWHPI CKQAARAEKK LKHRRTSETS ISPPGSSIGS PNRVICAKVD 300
NEILNYKDLA ALPKVKSIYE VQRPDLISYE PHSRYMSDEM LERCGYGESL 350
GTLSPYSQDI YENLDLRQRR ASSPGYIDSP TYSRQGMSPT FSRSPHHYYR 400
SGPESGRSSP YHSQLDVRSS TPTSYQAPKH FHIPAGDSNI YRKPPIYKRH 450
GDLSTATKSK TSEDISQTSK YSPIYSPDPY YASESEYWTY HGSPKVPRAR 500
RFSSGGEEDD FDRSMHKLQS GIGRLILKEE MKARSSSYAD PWTPPRSSTS 550
SREALHTAGY EMSLNGSPRS HYLADSDPLI SKSASLPAYR RNGLHRTPSA 600
DLFHYDSMNA VNWGMREYKI YPYELLLVTT RGRNRLPKDV DRTRLERHLS 650
QEEFYQVFGM TISEFDRLAL WKRNELKKQA RLF 683
Length:683
Mass (Da):77,802
Last modified:December 7, 2004 - v3
Checksum:i0392DBD9065EE08A
GO
Isoform 2 (identifier: O94929-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     297-358: Missing.
     402-450: Missing.
     647-683: RHLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF → GNFWKSGCL

Note: No experimental confirmation available.

Show »
Length:544
Mass (Da):61,570
Checksum:iE6A19F001BF02176
GO
Isoform 3 (identifier: O94929-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     297-358: Missing.
     402-434: Missing.

Note: No experimental confirmation available.

Show »
Length:588
Mass (Da):67,073
Checksum:i858F0D8EA50B1A57
GO
Isoform 4 (identifier: O94929-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-514: Missing.

Note: No experimental confirmation available.

Show »
Length:169
Mass (Da):19,695
Checksum:i18F1F045422E1552
GO

Sequence cautioni

The sequence BAA74866.2 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti125 – 1251G → D.
Corresponds to variant rs35907283 [ dbSNP | Ensembl ].
VAR_050143

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 514514Missing in isoform 4.
VSP_012126Add
BLAST
Alternative sequencei297 – 35862Missing in isoform 2 and isoform 3.
VSP_012127Add
BLAST
Alternative sequencei402 – 45049Missing in isoform 2.
VSP_012128Add
BLAST
Alternative sequencei402 – 43433Missing in isoform 3.
VSP_012129Add
BLAST
Alternative sequencei647 – 68337RHLSQ…QARLF → GNFWKSGCL in isoform 2.
VSP_012130Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti227 – 2271K → R in BAF82425. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ413174 mRNA. Translation: ABD83327.1.
AB020650 mRNA. Translation: BAA74866.2. Different initiation.
AK289736 mRNA. Translation: BAF82425.1.
AB075881 mRNA. Translation: BAD38663.1.
BC001665 mRNA. Translation: AAH01665.1.
AL833021 mRNA. Translation: CAH56270.1.
CCDSiCCDS4294.1. [O94929-1]
RefSeqiNP_055760.1. NM_014945.2. [O94929-1]
XP_005268449.1. XM_005268392.1.
XP_005268452.1. XM_005268395.1. [O94929-3]
XP_006714826.1. XM_006714763.1. [O94929-1]
UniGeneiHs.49688.

Genome annotation databases

EnsembliENST00000309868; ENSP00000310309; ENSG00000173210. [O94929-1]
ENST00000326685; ENSP00000315841; ENSG00000173210. [O94929-3]
ENST00000356541; ENSP00000348938; ENSG00000173210. [O94929-2]
ENST00000504238; ENSP00000421183; ENSG00000173210. [O94929-2]
ENST00000506113; ENSP00000425394; ENSG00000173210. [O94929-1]
ENST00000508983; ENSP00000420855; ENSG00000173210.
ENST00000517451; ENSP00000430150; ENSG00000173210. [O94929-4]
GeneIDi22885.
KEGGihsa:22885.
UCSCiuc003lpy.2. human. [O94929-1]
uc003lqa.1. human. [O94929-2]
uc003lqd.1. human. [O94929-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ413174 mRNA. Translation: ABD83327.1 .
AB020650 mRNA. Translation: BAA74866.2 . Different initiation.
AK289736 mRNA. Translation: BAF82425.1 .
AB075881 mRNA. Translation: BAD38663.1 .
BC001665 mRNA. Translation: AAH01665.1 .
AL833021 mRNA. Translation: CAH56270.1 .
CCDSi CCDS4294.1. [O94929-1 ]
RefSeqi NP_055760.1. NM_014945.2. [O94929-1 ]
XP_005268449.1. XM_005268392.1.
XP_005268452.1. XM_005268395.1. [O94929-3 ]
XP_006714826.1. XM_006714763.1. [O94929-1 ]
UniGenei Hs.49688.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1UJS NMR - A 609-683 [» ]
2DJ7 NMR - A 141-207 [» ]
ProteinModelPortali O94929.
SMRi O94929. Positions 6-268, 607-683.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116552. 3 interactions.
IntActi O94929. 4 interactions.
MINTi MINT-4657493.
STRINGi 9606.ENSP00000310309.

PTM databases

PhosphoSitei O94929.

Proteomic databases

MaxQBi O94929.
PaxDbi O94929.
PRIDEi O94929.

Protocols and materials databases

DNASUi 22885.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000309868 ; ENSP00000310309 ; ENSG00000173210 . [O94929-1 ]
ENST00000326685 ; ENSP00000315841 ; ENSG00000173210 . [O94929-3 ]
ENST00000356541 ; ENSP00000348938 ; ENSG00000173210 . [O94929-2 ]
ENST00000504238 ; ENSP00000421183 ; ENSG00000173210 . [O94929-2 ]
ENST00000506113 ; ENSP00000425394 ; ENSG00000173210 . [O94929-1 ]
ENST00000508983 ; ENSP00000420855 ; ENSG00000173210 .
ENST00000517451 ; ENSP00000430150 ; ENSG00000173210 . [O94929-4 ]
GeneIDi 22885.
KEGGi hsa:22885.
UCSCi uc003lpy.2. human. [O94929-1 ]
uc003lqa.1. human. [O94929-2 ]
uc003lqd.1. human. [O94929-3 ]

Organism-specific databases

CTDi 22885.
GeneCardsi GC05P148501.
HGNCi HGNC:29132. ABLIM3.
HPAi HPA003245.
MIMi 611305. gene.
neXtProti NX_O94929.
PharmGKBi PA134962761.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG302299.
HOGENOMi HOG000285997.
HOVERGENi HBG031499.
InParanoidi O94929.
KOi K07520.
OMAi DPYYASE.
OrthoDBi EOG71CFKF.
PhylomeDBi O94929.
TreeFami TF318042.

Enzyme and pathway databases

Reactomei REACT_22351. DCC mediated attractive signaling.

Miscellaneous databases

EvolutionaryTracei O94929.
GeneWikii ABLIM3.
GenomeRNAii 22885.
NextBioi 43475.
PROi O94929.
SOURCEi Search...

Gene expression databases

ArrayExpressi O94929.
Bgeei O94929.
CleanExi HS_ABLIM3.
Genevestigatori O94929.

Family and domain databases

Gene3Di 1.10.950.10. 1 hit.
2.10.110.10. 4 hits.
InterProi IPR028449. ABLIM3.
IPR003128. Villin_headpiece.
IPR001781. Znf_LIM.
[Graphical view ]
PANTHERi PTHR24213:SF0. PTHR24213:SF0. 1 hit.
Pfami PF00412. LIM. 4 hits.
PF02209. VHP. 1 hit.
[Graphical view ]
SMARTi SM00132. LIM. 4 hits.
SM00153. VHP. 1 hit.
[Graphical view ]
SUPFAMi SSF47050. SSF47050. 1 hit.
PROSITEi PS51089. HP. 1 hit.
PS00478. LIM_DOMAIN_1. 4 hits.
PS50023. LIM_DOMAIN_2. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Two novel members of the ABLIM protein family, ABLIM-2 and -3, associate with STARS and directly bind F-actin."
    Barrientos T., Frank D., Kuwahara K., Bezprozvannaya S., Pipes G.C.T., Bassel-Duby R., Richardson J.A., Katus H.A., Olson E.N., Frey N.
    J. Biol. Chem. 282:8393-8403(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH F-ACTIN AND ABRA.
    Tissue: Heart.
  2. "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
    Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
    Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Hepatoblastoma.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Colon.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 117-683 (ISOFORM 3).
    Tissue: Stomach.
  7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-503 AND SER-504, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Platelet.
  9. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
    Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
    Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-503 AND SER-504, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  10. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Solution structure of the villin headpiece domain of human actin-binding LIM protein homologue (KIAA0843 protein)."
    RIKEN structural genomics initiative (RSGI)
    Submitted (FEB-2004) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 610-683.

Entry informationi

Entry nameiABLM3_HUMAN
AccessioniPrimary (citable) accession number: O94929
Secondary accession number(s): A8K121
, Q19VH3, Q658S1, Q68CI5, Q9BV32
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: December 7, 2004
Last modified: September 3, 2014
This is version 124 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi