Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O94921

- CDK14_HUMAN

UniProt

O94921 - CDK14_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cyclin-dependent kinase 14

Gene

CDK14

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin. Acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by mediating the phosphorylation of LRP6 at 'Ser-1490', leading to the activation of the Wnt signaling pathway. Acts as a regulator of cell cycle progression and cell proliferation via its interaction with CCDN3. Phosphorylates RB1 in vitro, however the relevance of such result remains to be confirmed in vivo. May also play a role in meiosis, neuron differentiation and may indirectly act as a negative regulator of insulin-responsive glucose transport.4 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Enzyme regulationi

Serine/threonine-protein kinase activity is promoted by associated cyclins CCDN3 and CCNY and repressed by CDKN1A.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei164 – 1641ATPCurated
Active sitei256 – 2561Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi141 – 1499ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. cyclin binding Source: UniProtKB
  3. cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB

GO - Biological processi

  1. cell division Source: UniProtKB-KW
  2. G2/M transition of mitotic cell cycle Source: UniProtKB
  3. regulation of canonical Wnt signaling pathway Source: UniProtKB
  4. regulation of cell cycle Source: GOC
  5. Wnt signaling pathway Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Cell cycle, Cell division, Wnt signaling pathway

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiO94921.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 14 (EC:2.7.11.22)
Alternative name(s):
Cell division protein kinase 14
Serine/threonine-protein kinase PFTAIRE-1
Short name:
hPFTAIRE1
Gene namesi
Name:CDK14
Synonyms:KIAA0834, PFTK1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:8883. CDK14.

Subcellular locationi

Cell membrane; Peripheral membrane protein. Cytoplasm. Nucleus
Note: Recruited to the cell membrane by CCNY.

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. cytoplasmic cyclin-dependent protein kinase holoenzyme complex Source: UniProtKB
  3. cytosol Source: Ensembl
  4. nucleus Source: HPA
  5. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi164 – 1641K → R: Abolishes protein kinase activity. 2 Publications

Organism-specific databases

PharmGKBiPA33221.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 469469Cyclin-dependent kinase 14PRO_0000086506Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei95 – 951Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO94921.
PaxDbiO94921.
PRIDEiO94921.

PTM databases

PhosphoSiteiO94921.

Expressioni

Tissue specificityi

Highly expressed in brain, pancreas, kidney, heart, testis and ovary. Also detected at lower levels in other tissues except in spleen and thymus where expression is barely detected.1 Publication

Gene expression databases

BgeeiO94921.
CleanExiHS_PFTK1.
ExpressionAtlasiO94921. baseline and differential.
GenevestigatoriO94921.

Organism-specific databases

HPAiHPA015267.

Interactioni

Subunit structurei

Interacts with CCNY; CCNY mediates its recruitment to the plasma membrane and promotes phosphorylation of LRP6. Interacts with CCDN3 and CDKN1A. Interacts with SEPT8. Interacts with 14-3-3 proteina YWHAB, YWHAE, YWHAH and YWHAQ.5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CCND3P302815EBI-1043945,EBI-375013
CCNYQ8ND7611EBI-1043945,EBI-1049189
CDKN1AP389368EBI-1043945,EBI-375077
HSP90AB1P082382EBI-1043945,EBI-352572
YWHABP319465EBI-1043945,EBI-359815
YWHAEP622583EBI-1043945,EBI-356498
YWHAHQ049173EBI-1043945,EBI-306940
YWHAQP273483EBI-1043945,EBI-359854

Protein-protein interaction databases

BioGridi111239. 16 interactions.
DIPiDIP-39618N.
IntActiO94921. 13 interactions.
MINTiMINT-7147554.
STRINGi9606.ENSP00000265741.

Structurei

3D structure databases

ProteinModelPortaliO94921.
SMRiO94921. Positions 98-444.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini135 – 419285Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00600000083998.
HOVERGENiHBG014652.
InParanoidiO94921.
KOiK08821.
OMAiKKLRQAW.
PhylomeDBiO94921.
TreeFamiTF106508.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O94921-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCDLIEPQPA EKIGKMKKLR RTLSESFSRI ALKKDDTTFD EICVTKMSTR
60 70 80 90 100
NCQGMDSVIK PLDTIPEDKK VRVQRTQSTF DPFEKPANQV KRVHSENNAC
110 120 130 140 150
INFKTSSTGK ESPKVRRHSS PSSPTSPKFG KADSYEKLEK LGEGSYATVY
160 170 180 190 200
KGKSKVNGKL VALKVIRLQE EEGTPFTAIR EASLLKGLKH ANIVLLHDII
210 220 230 240 250
HTKETLTLVF EYVHTDLCQY MDKHPGGLHP DNVKLFLFQL LRGLSYIHQR
260 270 280 290 300
YILHRDLKPQ NLLISDTGEL KLADFGLARA KSVPSHTYSN EVVTLWYRPP
310 320 330 340 350
DVLLGSTEYS TCLDMWGVGC IFVEMIQGVA AFPGMKDIQD QLERIFLVLG
360 370 380 390 400
TPNEDTWPGV HSLPHFKPER FTLYSSKNLR QAWNKLSYVN HAEDLASKLL
410 420 430 440 450
QCSPKNRLSA QAALSHEYFS DLPPRLWELT DMSSIFTVPN VRLQPEAGES
460
MRAFGKNNSY GKSLSNSKH
Length:469
Mass (Da):53,057
Last modified:April 18, 2006 - v3
Checksum:i32CF9B9B7BD9CE0E
GO
Isoform 2 (identifier: O94921-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDE → MHGYFGCNAAAEPGYSAFVGTPQ

Show »
Length:451
Mass (Da):50,662
Checksum:i68210FCBC0D44031
GO
Isoform 3 (identifier: O94921-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: Missing.

Note: No experimental confirmation available.

Show »
Length:423
Mass (Da):47,760
Checksum:i5F5D5B2C611243FA
GO

Sequence cautioni

The sequence BAA74857.2 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti8 – 81Q → R in BAG60284. (PubMed:14702039)Curated
Sequence conflicti158 – 1581G → W in AAG43234. (PubMed:11313143)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti432 – 4321M → I in an ovarian mucinous carcinoma; somatic mutation. 1 Publication
VAR_046765
Natural varianti463 – 4631S → R.1 Publication
VAR_046766

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4646Missing in isoform 3. 1 PublicationVSP_038762Add
BLAST
Alternative sequencei1 – 4141MCDLI…TTFDE → MHGYFGCNAAAEPGYSAFVG TPQ in isoform 2. 2 PublicationsVSP_004803Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF119833 mRNA. Translation: AAG43234.1.
AB020641 mRNA. Translation: BAA74857.2. Different initiation.
AK289782 mRNA. Translation: BAF82471.1.
AK295086 mRNA. Translation: BAG58127.1.
AK297974 mRNA. Translation: BAG60284.1.
AK316026 mRNA. Translation: BAH14397.1.
AC000057 Genomic DNA. Translation: AAS07411.1.
AC000059 Genomic DNA. No translation available.
AC002065 Genomic DNA. Translation: AAM48566.1.
AC002456 Genomic DNA. No translation available.
AC002458 Genomic DNA. Translation: AAS07412.1.
AC006036 Genomic DNA. Translation: AAF19245.1.
CH236949 Genomic DNA. Translation: EAL24162.1.
CH471091 Genomic DNA. Translation: EAW76873.1.
CH471091 Genomic DNA. Translation: EAW76874.1.
BC136476 mRNA. Translation: AAI36477.1.
BC136477 mRNA. Translation: AAI36478.1.
BC152388 mRNA. Translation: AAI52389.1.
BC152436 mRNA. Translation: AAI52437.1.
BC167152 mRNA. Translation: AAI67152.1.
BC167156 mRNA. Translation: AAI67156.1.
CCDSiCCDS5619.1. [O94921-2]
CCDS75626.1. [O94921-1]
CCDS75627.1. [O94921-3]
RefSeqiNP_001274064.1. NM_001287135.1. [O94921-1]
NP_001274065.1. NM_001287136.1. [O94921-3]
NP_001274066.1. NM_001287137.1.
NP_036527.1. NM_012395.3. [O94921-2]
XP_005250495.1. XM_005250438.1. [O94921-3]
XP_005250496.1. XM_005250439.1. [O94921-3]
XP_006716089.1. XM_006716026.1. [O94921-3]
UniGeneiHs.258576.
Hs.430742.

Genome annotation databases

EnsembliENST00000265741; ENSP00000265741; ENSG00000058091. [O94921-2]
ENST00000380050; ENSP00000369390; ENSG00000058091. [O94921-1]
ENST00000406263; ENSP00000385034; ENSG00000058091. [O94921-3]
GeneIDi5218.
KEGGihsa:5218.
UCSCiuc003uky.2. human. [O94921-1]
uc003ukz.1. human. [O94921-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF119833 mRNA. Translation: AAG43234.1 .
AB020641 mRNA. Translation: BAA74857.2 . Different initiation.
AK289782 mRNA. Translation: BAF82471.1 .
AK295086 mRNA. Translation: BAG58127.1 .
AK297974 mRNA. Translation: BAG60284.1 .
AK316026 mRNA. Translation: BAH14397.1 .
AC000057 Genomic DNA. Translation: AAS07411.1 .
AC000059 Genomic DNA. No translation available.
AC002065 Genomic DNA. Translation: AAM48566.1 .
AC002456 Genomic DNA. No translation available.
AC002458 Genomic DNA. Translation: AAS07412.1 .
AC006036 Genomic DNA. Translation: AAF19245.1 .
CH236949 Genomic DNA. Translation: EAL24162.1 .
CH471091 Genomic DNA. Translation: EAW76873.1 .
CH471091 Genomic DNA. Translation: EAW76874.1 .
BC136476 mRNA. Translation: AAI36477.1 .
BC136477 mRNA. Translation: AAI36478.1 .
BC152388 mRNA. Translation: AAI52389.1 .
BC152436 mRNA. Translation: AAI52437.1 .
BC167152 mRNA. Translation: AAI67152.1 .
BC167156 mRNA. Translation: AAI67156.1 .
CCDSi CCDS5619.1. [O94921-2 ]
CCDS75626.1. [O94921-1 ]
CCDS75627.1. [O94921-3 ]
RefSeqi NP_001274064.1. NM_001287135.1. [O94921-1 ]
NP_001274065.1. NM_001287136.1. [O94921-3 ]
NP_001274066.1. NM_001287137.1.
NP_036527.1. NM_012395.3. [O94921-2 ]
XP_005250495.1. XM_005250438.1. [O94921-3 ]
XP_005250496.1. XM_005250439.1. [O94921-3 ]
XP_006716089.1. XM_006716026.1. [O94921-3 ]
UniGenei Hs.258576.
Hs.430742.

3D structure databases

ProteinModelPortali O94921.
SMRi O94921. Positions 98-444.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111239. 16 interactions.
DIPi DIP-39618N.
IntActi O94921. 13 interactions.
MINTi MINT-7147554.
STRINGi 9606.ENSP00000265741.

Chemistry

BindingDBi O94921.
ChEMBLi CHEMBL6162.
GuidetoPHARMACOLOGYi 1967.

PTM databases

PhosphoSitei O94921.

Proteomic databases

MaxQBi O94921.
PaxDbi O94921.
PRIDEi O94921.

Protocols and materials databases

DNASUi 5218.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265741 ; ENSP00000265741 ; ENSG00000058091 . [O94921-2 ]
ENST00000380050 ; ENSP00000369390 ; ENSG00000058091 . [O94921-1 ]
ENST00000406263 ; ENSP00000385034 ; ENSG00000058091 . [O94921-3 ]
GeneIDi 5218.
KEGGi hsa:5218.
UCSCi uc003uky.2. human. [O94921-1 ]
uc003ukz.1. human. [O94921-2 ]

Organism-specific databases

CTDi 5218.
GeneCardsi GC07P090095.
HGNCi HGNC:8883. CDK14.
HPAi HPA015267.
MIMi 610679. gene.
neXtProti NX_O94921.
PharmGKBi PA33221.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00600000083998.
HOVERGENi HBG014652.
InParanoidi O94921.
KOi K08821.
OMAi KKLRQAW.
PhylomeDBi O94921.
TreeFami TF106508.

Enzyme and pathway databases

SignaLinki O94921.

Miscellaneous databases

ChiTaRSi CDK14. human.
GeneWikii PFTK1.
GenomeRNAii 5218.
NextBioi 20182.
PROi O94921.
SOURCEi Search...

Gene expression databases

Bgeei O94921.
CleanExi HS_PFTK1.
ExpressionAtlasi O94921. baseline and differential.
Genevestigatori O94921.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF00069. Pkinase. 1 hit.
[Graphical view ]
SMARTi SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and cellular localization of human PFTAIRE1."
    Yang T., Chen J.-Y.
    Gene 267:165-172(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Cervix carcinoma.
  2. "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain and Testis.
  8. "KIAA0202, a human septin family member, interacting with hPFTAIRE1."
    Yang T., Gao Y.K., Chen J.Y.
    Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 34:520-525(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SEPT8.
  9. "A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins."
    Gao Y., Jiang M., Yang T., Ni J., Chen J.
    Cell Res. 16:539-547(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH YWHAB; YWHAE; YWHAH AND YWHAQ.
  10. "An RNA interference-based screen identifies MAP4K4/NIK as a negative regulator of PPARgamma, adipogenesis, and insulin-responsive hexose transport."
    Tang X., Guilherme A., Chakladar A., Powelka A.M., Konda S., Virbasius J.V., Nicoloro S.M., Straubhaar J., Czech M.P.
    Proc. Natl. Acad. Sci. U.S.A. 103:2087-2092(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. "Functional characterization of human PFTK1 as a cyclin-dependent kinase."
    Shu F., Lv S., Qin Y., Ma X., Wang X., Peng X., Luo Y., Xu B.E., Sun X., Wu J.
    Proc. Natl. Acad. Sci. U.S.A. 104:9248-9253(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CCDN3 AND CDKN1A, MUTAGENESIS OF LYS-164.
  12. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-95, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH CCNY.
  14. "Cyclin Y, a novel membrane-associated cyclin, interacts with PFTK1."
    Jiang M., Gao Y., Yang T., Zhu X., Chen J.
    FEBS Lett. 583:2171-2178(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CCNY, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-164.
  15. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-95, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] ILE-432 AND ARG-463.

Entry informationi

Entry nameiCDK14_HUMAN
AccessioniPrimary (citable) accession number: O94921
Secondary accession number(s): A4D1E6
, A6NK51, A8WFP6, B4DHG5, B4DNM2, Q75N06, Q75N22, Q8N764, Q9H3D7, Q9UDR0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2002
Last sequence update: April 18, 2006
Last modified: October 29, 2014
This is version 143 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3