O94921 (CDK14_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cyclin-dependent kinase 14 EC=2.7.11.22 Alternative name(s): Cell division protein kinase 14 Serine/threonine-protein kinase PFTAIRE-1 Short name=hPFTAIRE1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 469 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin. Acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by mediating the phosphorylation of LRP6 at 'Ser-1490', leading to the activation of the Wnt signaling pathway. Acts as a regulator of cell cycle progression and cell proliferation via its interaction with CCDN3. Phosphorylates RB1 in vitro, however the relevance of such result remains to be confirmed in vivo. May also play a role in meiosis, neuron differentiation and may indirectly act as a negative regulator of insulin-responsive glucose transport. Ref.10 Ref.11 Ref.13 Ref.14 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Enzyme regulation | Serine/threonine-protein kinase activity is promoted by associated cyclins CCDN3 and CCNY and repressed by CDKN1A. |
| Subunit structure | Interacts with CCNY; CCNY mediates its recruitment to the plasma membrane and promotes phosphorylation of LRP6. Interacts with CCDN3 and CDKN1A. Interacts with SEPT8. Interacts with 14-3-3 proteina YWHAB, YWHAE, YWHAH and YWHAQ. Ref.8 Ref.9 Ref.11 Ref.13 Ref.14 |
| Subcellular location | Cell membrane; Peripheral membrane protein. Cytoplasm. Nucleus. Note: Recruited to the cell membrane by CCNY. Ref.1 Ref.13 Ref.14 |
| Tissue specificity | Highly expressed in brain, pancreas, kidney, heart, testis and ovary. Also detected at lower levels in other tissues except in spleen and thymus where expression is barely detected. Ref.1 |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. Contains 1 protein kinase domain. |
| Sequence caution | The sequence BAA74857.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CCND3 | P30281 | 5 | EBI-1043945,EBI-375013 | |
| CDKN1A | P38936 | 7 | EBI-1043945,EBI-375077 | |
| YWHAB | P31946 | 5 | EBI-1043945,EBI-359815 | |
| YWHAE | P62258 | 3 | EBI-1043945,EBI-356498 | |
| YWHAH | Q04917 | 3 | EBI-1043945,EBI-306940 | |
| YWHAQ | P27348 | 3 | EBI-1043945,EBI-359854 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94921-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94921-2) The sequence of this isoform differs from the canonical sequence as follows: 1-41: MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDE → MHGYFGCNAAAEPGYSAFVGTPQ | ||||||
| Isoform 3 (identifier: O94921-3) The sequence of this isoform differs from the canonical sequence as follows: 1-46: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 469 | 469 | Cyclin-dependent kinase 14 | PRO_0000086506 | |||||
Regions | |||||||||
| Domain | 135 – 419 | 285 | Protein kinase | ||||||
| Nucleotide binding | 141 – 149 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 256 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 164 | 1 | ATP Probable | ||||||
Amino acid modifications | |||||||||
| Modified residue | 22 | 1 | Phosphothreonine Ref.15 | ||||||
| Modified residue | 24 | 1 | Phosphoserine Ref.12 Ref.15 | ||||||
| Modified residue | 76 | 1 | Phosphothreonine Ref.15 | ||||||
| Modified residue | 95 | 1 | Phosphoserine Ref.12 Ref.15 | ||||||
| Modified residue | 119 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 120 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 122 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 123 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 134 | 1 | Phosphoserine Ref.12 Ref.15 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 46 | 46 | Missing in isoform 3. | VSP_038762 | |||||
| Alternative sequence | 1 – 41 | 41 | MCDLI…TTFDE → MHGYFGCNAAAEPGYSAFVG TPQ in isoform 2. | VSP_004803 | |||||
| Natural variant | 432 | 1 | M → I in an ovarian mucinous carcinoma; somatic mutation. Ref.16 | VAR_046765 | |||||
| Natural variant | 463 | 1 | S → R. Ref.16 | VAR_046766 | |||||
Experimental info | |||||||||
| Mutagenesis | 164 | 1 | K → R: Abolishes protein kinase activity. Ref.11 Ref.14 | ||||||
| Sequence conflict | 8 | 1 | Q → R in BAG60284. Ref.3 | ||||||
| Sequence conflict | 158 | 1 | G → W in AAG43234. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and cellular localization of human PFTAIRE1." Yang T., Chen J.-Y. Gene 267:165-172(2001) [PubMed: 11313143] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Cervix carcinoma. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:355-364(1998) [PubMed: 10048485] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Human chromosome 7: DNA sequence and biology." Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. Tsui L.-C.Science 300:767-772(2003) [PubMed: 12690205] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain and Testis. |
| [8] | "KIAA0202, a human septin family member, interacting with hPFTAIRE1." Yang T., Gao Y.K., Chen J.Y. Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 34:520-525(2002) [PubMed: 12098780] [Abstract] Cited for: INTERACTION WITH SEPT8. |
| [9] | "A Cdc2-related protein kinase hPFTAIRE1 from human brain interacting with 14-3-3 proteins." Gao Y., Jiang M., Yang T., Ni J., Chen J. Cell Res. 16:539-547(2006) [PubMed: 16775625] [Abstract] Cited for: INTERACTION WITH YWHAB; YWHAE; YWHAH AND YWHAQ. |
| [10] | "An RNA interference-based screen identifies MAP4K4/NIK as a negative regulator of PPARgamma, adipogenesis, and insulin-responsive hexose transport." Tang X., Guilherme A., Chakladar A., Powelka A.M., Konda S., Virbasius J.V., Nicoloro S.M., Straubhaar J., Czech M.P. Proc. Natl. Acad. Sci. U.S.A. 103:2087-2092(2006) [PubMed: 16461467] [Abstract] Cited for: FUNCTION. |
| [11] | "Functional characterization of human PFTK1 as a cyclin-dependent kinase." Shu F., Lv S., Qin Y., Ma X., Wang X., Peng X., Luo Y., Xu B.E., Sun X., Wu J. Proc. Natl. Acad. Sci. U.S.A. 104:9248-9253(2007) [PubMed: 17517622] [Abstract] Cited for: FUNCTION, INTERACTION WITH CCDN3 AND CDKN1A, MUTAGENESIS OF LYS-164. |
| [12] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-24; SER-95 AND SER-134, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Cell cycle control of wnt receptor activation." Davidson G., Shen J., Huang Y.L., Su Y., Karaulanov E., Bartscherer K., Hassler C., Stannek P., Boutros M., Niehrs C. Dev. Cell 17:788-799(2009) [PubMed: 20059949] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH CCNY. |
| [14] | "Cyclin Y, a novel membrane-associated cyclin, interacts with PFTK1." Jiang M., Gao Y., Yang T., Zhu X., Chen J. FEBS Lett. 583:2171-2178(2009) [PubMed: 19524571] [Abstract] Cited for: FUNCTION, INTERACTION WITH CCNY, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-164. |
| [15] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-22; SER-24; THR-76; SER-95; SER-119; SER-120; SER-122; SER-123 AND SER-134, MASS SPECTROMETRY. |
| [16] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ILE-432 AND ARG-463. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF119833 mRNA. Translation: AAG43234.1. AB020641 mRNA. Translation: BAA74857.2. Different initiation. AK289782 mRNA. Translation: BAF82471.1. AK295086 mRNA. Translation: BAG58127.1. AK297974 mRNA. Translation: BAG60284.1. AK316026 mRNA. Translation: BAH14397.1. AC000057 Genomic DNA. Translation: AAS07411.1. AC000059 Genomic DNA. No translation available. AC002065 Genomic DNA. Translation: AAM48566.1. AC002456 Genomic DNA. No translation available. AC002458 Genomic DNA. Translation: AAS07412.1. AC006036 Genomic DNA. Translation: AAF19245.1. CH236949 Genomic DNA. Translation: EAL24162.1. CH471091 Genomic DNA. Translation: EAW76873.1. CH471091 Genomic DNA. Translation: EAW76874.1. BC136476 mRNA. Translation: AAI36477.1. BC136477 mRNA. Translation: AAI36478.1. BC152388 mRNA. Translation: AAI52389.1. BC152436 mRNA. Translation: AAI52437.1. BC167152 mRNA. Translation: AAI67152.1. BC167156 mRNA. Translation: AAI67156.1. |
| IPI | IPI00165249. IPI00742856. IPI00877696. |
| RefSeq | NP_036527.1. NM_012395.2. |
| UniGene | Hs.258576. |
3D structure databases | |
| ProteinModelPortal | O94921. |
| SMR | O94921. Positions 133-443. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O94921. 7 interactions. |
| MINT | MINT-7147554. |
| STRING | O94921. |
PTM databases | |
| PhosphoSite | O94921. |
Proteomic databases | |
| PRIDE | O94921. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000380050; ENSP00000369390; ENSG00000058091. |
| GeneID | 5218. |
| KEGG | hsa:5218. |
| UCSC | uc003uky.1. human. uc003ukz.1. human. |
Organism-specific databases | |
| CTD | 5218. |
| GeneCards | GC07P090095. |
| H-InvDB | HIX0201113. |
| HGNC | HGNC:8883. CDK14. |
| HPA | HPA015267. |
| MIM | 610679. gene. |
| neXtProt | NX_O94921. |
| PharmGKB | PA165617874. PA33221. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00600000083998. |
| HOVERGEN | HBG014652. |
| InParanoid | O94921. |
| OMA | FPKNRLS. |
| PhylomeDB | O94921. |
Gene expression databases | |
| ArrayExpress | O94921. |
| Bgee | O94921. |
| CleanEx | HS_PFTK1. |
| Genevestigator | O94921. |
| GermOnline | ENSG00000058091. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_kinase-like_dom. IPR008271. Ser/Thr_kinase_AS. IPR002290. Ser/Thr_kinase_dom. [Graphical view] |
| KO | K08821. |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 20182. |
| SOURCE | Search... |
Entry information
| Entry name | CDK14_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94921 Secondary accession number(s): A4D1E6 Q9UDR0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with