Reviewed,
UniProtKB/Swiss-Prot O94921 (PFTK1_HUMAN)
Last modified
September 23, 2008.
Version 77.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Serine/threonine-protein kinase PFTAIRE-1 EC=2.7.11.22 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 469 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May play a role in meiosis as well as in neuron differentiation and/or function By similarity. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Subcellular location | |
| Tissue specificity | Highly expressed in brain, pancreas, kidney, heart, testis and ovary. Also detected at lower levels in other tissues except in spleen and thymus where expression is barely detected. |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. Contains 1 protein kinase domain. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
Gene Ontology (GO) | |
| Cellular component | cytoplasm Traceable author statement. Source: ProtInc nucleusTraceable author statement. Source: ProtInc |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CCND3 | P30281 | 4 | EBI-1043945,EBI-375013 | |
| CDKN1A | P38936 | 4 | EBI-1043945,EBI-375077 | |
| IGHA2 | P01877 | 1 | EBI-1043945,EBI-1044357 | |
| YWHAB | P31946 | 5 | EBI-1043945,EBI-359815 | |
| YWHAE | P62258 | 3 | EBI-1043945,EBI-356498 | |
| YWHAH | Q04917 | 3 | EBI-1043945,EBI-306940 | |
| YWHAQ | P27348 | 3 | EBI-1043945,EBI-359854 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: O94921-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: O94921-2) The sequence of this isoform differs from the canonical sequence as follows: 1-41: MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDE → MHGYFGCNAAAEPGYSAFVGTPQ | |||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 469 | 469 | Serine/threonine-protein kinase PFTAIRE-1 | |||||
Regions | ||||||||
| Domain | 135 – 419 | 285 | Protein kinase | |||||
| Nucleotide binding | 141 – 149 | 9 | ATP By similarity | |||||
Sites | ||||||||
| Active site | 256 | 1 | Proton acceptor By similarity | |||||
| Binding site | 164 | 1 | ATP By similarity | |||||
Natural variations | ||||||||
| Alternative sequence | 1 – 41 | 41 | MCDLI…TTFDE → MHGYFGCNAAAEPGYSAFVG TPQ in isoform 2. | |||||
Experimental info | ||||||||
| Sequence conflict | 158 | 1 | G → W in AAG43234. Ref.1 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and cellular localization of human PFTAIRE1." Yang T., Chen J.-Y. Gene 267:165-172(2001) [PubMed: 11313143] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Cervix carcinoma. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:355-364(1998) [PubMed: 10048485] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF119833 mRNA. Translation: AAG43234.1. AB020641 mRNA. Translation: BAA74857.2. Different initiation. AC000057 Genomic DNA. Translation: AAS07411.1. AC000059 Genomic DNA. No translation available. AC002065 Genomic DNA. Translation: AAM48566.1. AC002456 Genomic DNA. No translation available. AC002458 Genomic DNA. Translation: AAS07412.1. AC006036 Genomic DNA. Translation: AAF19245.1. | |
| RefSeq | NP_036527.1. |
| UniGene | Hs.430742 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1GII based on UniProtKB P24941. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O94921. |
Genome annotation databases | |
| Ensembl | ENSG00000058091. Homo sapiens. [Contig view] |
| GeneID | 5218. |
| KEGG | hsa:5218. |
Organism-specific databases | |
| HGNC | HGNC:8883. PFTK1. |
| HPA | HPA015267. |
| MIM | 610679. gene. |
| PharmGKB | PA33221. |
| HUGE | Search... |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOGENOM | O94921. |
| HOVERGEN | O94921. |
Gene expression databases | |
| ArrayExpress | O94921. |
| CleanEx | HS_PFTK1. |
| GermOnline | ENSG00000058091. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_bd_CS. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. IPR002290. Ser_thr_pkinase. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| BLOCKS | Search... |
Other Resources | |
| SOURCE | Search... |
| ProtoNet | Search... |
Entry information
| Entry name | PFTK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94921 Secondary accession number(s): A6NK51 Q9UDR0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |

Clusters with


