Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase 14

Gene

CDK14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin. Acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by mediating the phosphorylation of LRP6 at 'Ser-1490', leading to the activation of the Wnt signaling pathway. Acts as a regulator of cell cycle progression and cell proliferation via its interaction with CCDN3. Phosphorylates RB1 in vitro, however the relevance of such result remains to be confirmed in vivo. May also play a role in meiosis, neuron differentiation and may indirectly act as a negative regulator of insulin-responsive glucose transport.4 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Enzyme regulationi

Serine/threonine-protein kinase activity is promoted by associated cyclins CCDN3 and CCNY and repressed by CDKN1A.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei164ATPCurated1
Active sitei256Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi141 – 149ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • cyclin binding Source: UniProtKB
  • cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • G2/M transition of mitotic cell cycle Source: UniProtKB
  • regulation of canonical Wnt signaling pathway Source: UniProtKB
  • Wnt signaling pathway Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Cell cycle, Cell division, Wnt signaling pathway

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS00718-MONOMER.
SignaLinkiO94921.
SIGNORiO94921.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 14 (EC:2.7.11.22)
Alternative name(s):
Cell division protein kinase 14
Serine/threonine-protein kinase PFTAIRE-1
Short name:
hPFTAIRE1
Gene namesi
Name:CDK14
Synonyms:KIAA0834, PFTK1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:8883. CDK14.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • cytoplasmic cyclin-dependent protein kinase holoenzyme complex Source: UniProtKB
  • cytosol Source: Ensembl
  • nucleus Source: HPA
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi164K → R: Abolishes protein kinase activity. 2 Publications1

Organism-specific databases

DisGeNETi5218.
OpenTargetsiENSG00000058091.
PharmGKBiPA33221.

Chemistry databases

ChEMBLiCHEMBL6162.
GuidetoPHARMACOLOGYi1967.

Polymorphism and mutation databases

BioMutaiCDK14.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000865061 – 469Cyclin-dependent kinase 14Add BLAST469

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei24PhosphoserineCombined sources1
Modified residuei78PhosphoserineCombined sources1
Modified residuei95PhosphoserineCombined sources1
Modified residuei134PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO94921.
MaxQBiO94921.
PaxDbiO94921.
PeptideAtlasiO94921.
PRIDEiO94921.

PTM databases

iPTMnetiO94921.
PhosphoSitePlusiO94921.

Expressioni

Tissue specificityi

Highly expressed in brain, pancreas, kidney, heart, testis and ovary. Also detected at lower levels in other tissues except in spleen and thymus where expression is barely detected.1 Publication

Gene expression databases

BgeeiENSG00000058091.
CleanExiHS_PFTK1.
ExpressionAtlasiO94921. baseline and differential.
GenevisibleiO94921. HS.

Organism-specific databases

HPAiHPA015267.

Interactioni

Subunit structurei

Interacts with CCNY; CCNY mediates its recruitment to the plasma membrane and promotes phosphorylation of LRP6. Interacts with CCDN3 and CDKN1A. Interacts with SEPT8. Interacts with 14-3-3 proteina YWHAB, YWHAE, YWHAH and YWHAQ.5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CCND3P302815EBI-1043945,EBI-375013
CCNYQ8ND767EBI-1043945,EBI-1049189
CDKN1AP389368EBI-1043945,EBI-375077
HSP90AB1P082382EBI-1043945,EBI-352572
YWHABP319465EBI-1043945,EBI-359815
YWHAEP622583EBI-1043945,EBI-356498
YWHAHQ049173EBI-1043945,EBI-306940
YWHAQP273483EBI-1043945,EBI-359854

GO - Molecular functioni

  • cyclin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi111239. 19 interactors.
DIPiDIP-39618N.
IntActiO94921. 13 interactors.
MINTiMINT-7147554.
STRINGi9606.ENSP00000265741.

Chemistry databases

BindingDBiO94921.

Structurei

3D structure databases

ProteinModelPortaliO94921.
SMRiO94921.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini135 – 419Protein kinasePROSITE-ProRule annotationAdd BLAST285

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0594. Eukaryota.
ENOG410XPP3. LUCA.
GeneTreeiENSGT00790000122986.
HOVERGENiHBG014652.
InParanoidiO94921.
KOiK08821.
OMAiLQCFPKN.
OrthoDBiEOG091G0CH0.
PhylomeDBiO94921.
TreeFamiTF106508.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O94921-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCDLIEPQPA EKIGKMKKLR RTLSESFSRI ALKKDDTTFD EICVTKMSTR
60 70 80 90 100
NCQGMDSVIK PLDTIPEDKK VRVQRTQSTF DPFEKPANQV KRVHSENNAC
110 120 130 140 150
INFKTSSTGK ESPKVRRHSS PSSPTSPKFG KADSYEKLEK LGEGSYATVY
160 170 180 190 200
KGKSKVNGKL VALKVIRLQE EEGTPFTAIR EASLLKGLKH ANIVLLHDII
210 220 230 240 250
HTKETLTLVF EYVHTDLCQY MDKHPGGLHP DNVKLFLFQL LRGLSYIHQR
260 270 280 290 300
YILHRDLKPQ NLLISDTGEL KLADFGLARA KSVPSHTYSN EVVTLWYRPP
310 320 330 340 350
DVLLGSTEYS TCLDMWGVGC IFVEMIQGVA AFPGMKDIQD QLERIFLVLG
360 370 380 390 400
TPNEDTWPGV HSLPHFKPER FTLYSSKNLR QAWNKLSYVN HAEDLASKLL
410 420 430 440 450
QCSPKNRLSA QAALSHEYFS DLPPRLWELT DMSSIFTVPN VRLQPEAGES
460
MRAFGKNNSY GKSLSNSKH
Length:469
Mass (Da):53,057
Last modified:April 18, 2006 - v3
Checksum:i32CF9B9B7BD9CE0E
GO
Isoform 2 (identifier: O94921-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDE → MHGYFGCNAAAEPGYSAFVGTPQ

Show »
Length:451
Mass (Da):50,662
Checksum:i68210FCBC0D44031
GO
Isoform 3 (identifier: O94921-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: Missing.

Note: No experimental confirmation available.
Show »
Length:423
Mass (Da):47,760
Checksum:i5F5D5B2C611243FA
GO

Sequence cautioni

The sequence BAA74857 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8Q → R in BAG60284 (PubMed:14702039).Curated1
Sequence conflicti158G → W in AAG43234 (PubMed:11313143).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_046765432M → I in an ovarian mucinous carcinoma; somatic mutation. 1 PublicationCorresponds to variant rs773301216dbSNPEnsembl.1
Natural variantiVAR_046766463S → R.1 PublicationCorresponds to variant rs35643773dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0387621 – 46Missing in isoform 3. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_0048031 – 41MCDLI…TTFDE → MHGYFGCNAAAEPGYSAFVG TPQ in isoform 2. 2 PublicationsAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF119833 mRNA. Translation: AAG43234.1.
AB020641 mRNA. Translation: BAA74857.2. Different initiation.
AK289782 mRNA. Translation: BAF82471.1.
AK295086 mRNA. Translation: BAG58127.1.
AK297974 mRNA. Translation: BAG60284.1.
AK316026 mRNA. Translation: BAH14397.1.
AC000057 Genomic DNA. Translation: AAS07411.1.
AC000059 Genomic DNA. No translation available.
AC002065 Genomic DNA. Translation: AAM48566.1.
AC002456 Genomic DNA. No translation available.
AC002458 Genomic DNA. Translation: AAS07412.1.
AC006036 Genomic DNA. Translation: AAF19245.1.
CH236949 Genomic DNA. Translation: EAL24162.1.
CH471091 Genomic DNA. Translation: EAW76873.1.
CH471091 Genomic DNA. Translation: EAW76874.1.
BC136476 mRNA. Translation: AAI36477.1.
BC136477 mRNA. Translation: AAI36478.1.
BC152388 mRNA. Translation: AAI52389.1.
BC152436 mRNA. Translation: AAI52437.1.
BC167152 mRNA. Translation: AAI67152.1.
BC167156 mRNA. Translation: AAI67156.1.
CCDSiCCDS5619.1. [O94921-2]
CCDS75626.1. [O94921-1]
CCDS75627.1. [O94921-3]
RefSeqiNP_001274064.1. NM_001287135.1. [O94921-1]
NP_001274065.1. NM_001287136.1. [O94921-3]
NP_001274066.1. NM_001287137.1.
NP_036527.1. NM_012395.3. [O94921-2]
XP_005250495.1. XM_005250438.3. [O94921-3]
XP_005250496.1. XM_005250439.2. [O94921-3]
XP_011514608.1. XM_011516306.2. [O94921-1]
XP_016867809.1. XM_017012320.1. [O94921-3]
XP_016867810.1. XM_017012321.1. [O94921-3]
XP_016867811.1. XM_017012322.1. [O94921-3]
UniGeneiHs.258576.
Hs.430742.
Hs.740065.

Genome annotation databases

EnsembliENST00000265741; ENSP00000265741; ENSG00000058091. [O94921-2]
ENST00000380050; ENSP00000369390; ENSG00000058091. [O94921-1]
ENST00000406263; ENSP00000385034; ENSG00000058091. [O94921-3]
GeneIDi5218.
KEGGihsa:5218.
UCSCiuc003uky.4. human. [O94921-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF119833 mRNA. Translation: AAG43234.1.
AB020641 mRNA. Translation: BAA74857.2. Different initiation.
AK289782 mRNA. Translation: BAF82471.1.
AK295086 mRNA. Translation: BAG58127.1.
AK297974 mRNA. Translation: BAG60284.1.
AK316026 mRNA. Translation: BAH14397.1.
AC000057 Genomic DNA. Translation: AAS07411.1.
AC000059 Genomic DNA. No translation available.
AC002065 Genomic DNA. Translation: AAM48566.1.
AC002456 Genomic DNA. No translation available.
AC002458 Genomic DNA. Translation: AAS07412.1.
AC006036 Genomic DNA. Translation: AAF19245.1.
CH236949 Genomic DNA. Translation: EAL24162.1.
CH471091 Genomic DNA. Translation: EAW76873.1.
CH471091 Genomic DNA. Translation: EAW76874.1.
BC136476 mRNA. Translation: AAI36477.1.
BC136477 mRNA. Translation: AAI36478.1.
BC152388 mRNA. Translation: AAI52389.1.
BC152436 mRNA. Translation: AAI52437.1.
BC167152 mRNA. Translation: AAI67152.1.
BC167156 mRNA. Translation: AAI67156.1.
CCDSiCCDS5619.1. [O94921-2]
CCDS75626.1. [O94921-1]
CCDS75627.1. [O94921-3]
RefSeqiNP_001274064.1. NM_001287135.1. [O94921-1]
NP_001274065.1. NM_001287136.1. [O94921-3]
NP_001274066.1. NM_001287137.1.
NP_036527.1. NM_012395.3. [O94921-2]
XP_005250495.1. XM_005250438.3. [O94921-3]
XP_005250496.1. XM_005250439.2. [O94921-3]
XP_011514608.1. XM_011516306.2. [O94921-1]
XP_016867809.1. XM_017012320.1. [O94921-3]
XP_016867810.1. XM_017012321.1. [O94921-3]
XP_016867811.1. XM_017012322.1. [O94921-3]
UniGeneiHs.258576.
Hs.430742.
Hs.740065.

3D structure databases

ProteinModelPortaliO94921.
SMRiO94921.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111239. 19 interactors.
DIPiDIP-39618N.
IntActiO94921. 13 interactors.
MINTiMINT-7147554.
STRINGi9606.ENSP00000265741.

Chemistry databases

BindingDBiO94921.
ChEMBLiCHEMBL6162.
GuidetoPHARMACOLOGYi1967.

PTM databases

iPTMnetiO94921.
PhosphoSitePlusiO94921.

Polymorphism and mutation databases

BioMutaiCDK14.

Proteomic databases

EPDiO94921.
MaxQBiO94921.
PaxDbiO94921.
PeptideAtlasiO94921.
PRIDEiO94921.

Protocols and materials databases

DNASUi5218.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265741; ENSP00000265741; ENSG00000058091. [O94921-2]
ENST00000380050; ENSP00000369390; ENSG00000058091. [O94921-1]
ENST00000406263; ENSP00000385034; ENSG00000058091. [O94921-3]
GeneIDi5218.
KEGGihsa:5218.
UCSCiuc003uky.4. human. [O94921-1]

Organism-specific databases

CTDi5218.
DisGeNETi5218.
GeneCardsiCDK14.
HGNCiHGNC:8883. CDK14.
HPAiHPA015267.
MIMi610679. gene.
neXtProtiNX_O94921.
OpenTargetsiENSG00000058091.
PharmGKBiPA33221.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0594. Eukaryota.
ENOG410XPP3. LUCA.
GeneTreeiENSGT00790000122986.
HOVERGENiHBG014652.
InParanoidiO94921.
KOiK08821.
OMAiLQCFPKN.
OrthoDBiEOG091G0CH0.
PhylomeDBiO94921.
TreeFamiTF106508.

Enzyme and pathway databases

BioCyciZFISH:HS00718-MONOMER.
SignaLinkiO94921.
SIGNORiO94921.

Miscellaneous databases

ChiTaRSiCDK14. human.
GeneWikiiPFTK1.
GenomeRNAii5218.
PROiO94921.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000058091.
CleanExiHS_PFTK1.
ExpressionAtlasiO94921. baseline and differential.
GenevisibleiO94921. HS.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCDK14_HUMAN
AccessioniPrimary (citable) accession number: O94921
Secondary accession number(s): A4D1E6
, A6NK51, A8WFP6, B4DHG5, B4DNM2, Q75N06, Q75N22, Q8N764, Q9H3D7, Q9UDR0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2002
Last sequence update: April 18, 2006
Last modified: November 2, 2016
This is version 162 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.