Reviewed,
UniProtKB/Swiss-Prot O94921 (CDK14_HUMAN)
Last modified
February 9, 2010.
Version 95.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Cell division protein kinase 14 EC=2.7.11.22 Alternative name(s): Serine/threonine-protein kinase PFTAIRE-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 469 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May play a role in meiosis as well as in neuron differentiation and/or function By similarity. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Subcellular location | |
| Tissue specificity | Highly expressed in brain, pancreas, kidney, heart, testis and ovary. Also detected at lower levels in other tissues except in spleen and thymus where expression is barely detected. Ref.1 |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | protein amino acid phosphorylation Inferred from electronic annotation. Source: InterPro |
| Cellular component | nucleus Inferred from direct assay. Source: HPA |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW cyclin-dependent protein kinase activityInferred from electronic annotation. Source: EC protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CCND3 | P30281 | 4 | EBI-1043945,EBI-375013 | |
| CDKN1A | P38936 | 4 | EBI-1043945,EBI-375077 | |
| IGHA2 | P01877 | 1 | EBI-1043945,EBI-1044357 | |
| YWHAB | P31946 | 5 | EBI-1043945,EBI-359815 | |
| YWHAE | P62258 | 3 | EBI-1043945,EBI-356498 | |
| YWHAH | Q04917 | 3 | EBI-1043945,EBI-306940 | |
| YWHAQ | P27348 | 3 | EBI-1043945,EBI-359854 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94921-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94921-2) The sequence of this isoform differs from the canonical sequence as follows: 1-41: MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDE → MHGYFGCNAAAEPGYSAFVGTPQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 469 | 469 | Cell division protein kinase 14 | PRO_0000086506 | |||||
Regions | |||||||||
| Domain | 135 – 419 | 285 | Protein kinase | ||||||
| Nucleotide binding | 141 – 149 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 256 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 164 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 22 | 1 | Phosphothreonine | ||||||
| Modified residue | 24 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 76 | 1 | Phosphothreonine | ||||||
| Modified residue | 95 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 119 | 1 | Phosphoserine | ||||||
| Modified residue | 120 | 1 | Phosphoserine | ||||||
| Modified residue | 122 | 1 | Phosphoserine | ||||||
| Modified residue | 123 | 1 | Phosphoserine | ||||||
| Modified residue | 134 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 41 | 41 | MCDLI…TTFDE → MHGYFGCNAAAEPGYSAFVG TPQ in isoform 2. | VSP_004803 | |||||
| Natural variant | 432 | 1 | M → I in an ovarian mucinous carcinoma; somatic mutation. Ref.6 | VAR_046765 | |||||
| Natural variant | 463 | 1 | S → R | VAR_046766 | |||||
Experimental info | |||||||||
| Sequence conflict | 158 | 1 | G → W in AAG43234. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and cellular localization of human PFTAIRE1." Yang T., Chen J.-Y. Gene 267:165-172(2001) [PubMed: 11313143] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Cervix carcinoma. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:355-364(1998) [PubMed: 10048485] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-24; SER-95 AND SER-134, MASS SPECTROMETRY. |
| [5] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-22; SER-24; THR-76; SER-95; SER-119; SER-120; SER-122; SER-123 AND SER-134, MASS SPECTROMETRY. |
| [6] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ILE-432 AND ARG-463. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF119833 mRNA. Translation: AAG43234.1. AB020641 mRNA. Translation: BAA74857.2. Different initiation. AC000057 Genomic DNA. Translation: AAS07411.1. AC000059 Genomic DNA. No translation available. AC002065 Genomic DNA. Translation: AAM48566.1. AC002456 Genomic DNA. No translation available. AC002458 Genomic DNA. Translation: AAS07412.1. AC006036 Genomic DNA. Translation: AAF19245.1. |
| IPI | IPI00165249. IPI00742856. |
| RefSeq | NP_036527.1. |
| UniGene | Hs.430742 |
3D structure databases | |
| SMR | O94921. Positions 135-422. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O94921. 7 interactions. |
| STRING | O94921. |
PTM databases | |
| PhosphoSite | O94921. |
Proteomic databases | |
| PRIDE | O94921. |
Genome annotation databases | |
| Ensembl | ENST00000380050; ENSP00000369390; ENSG00000058091; Homo sapiens. [Genome view] |
| GeneID | 5218. |
| KEGG | hsa:5218. |
| UCSC | uc003uky.1. human. uc003ukz.1. human. |
Organism-specific databases | |
| CTD | 5218. |
| GeneCards | GC07P089983. |
| HGNC | HGNC:8883. CDK14. |
| HPA | HPA015267. |
| MIM | 610679. gene. |
| PharmGKB | PA33221. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | O94921. |
| InParanoid | O94921. |
| OMA | FPKNRLS. |
| PhylomeDB | O94921. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.22. 247. |
Gene expression databases | |
| ArrayExpress | O94921. |
| Bgee | O94921. |
| CleanEx | HS_PFTK1. |
| Genevestigator | O94921. |
| GermOnline | ENSG00000058091. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_prot_kinase-like_dom. IPR008271. Ser/Thr_prot_kinase_AS. IPR002290. Ser/Thr_prot_kinase_dom. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 20182. |
| SOURCE | Search... |
Entry information
| Entry name | CDK14_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94921 Secondary accession number(s): A6NK51 Q9UDR0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


