Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O94901

- SUN1_HUMAN

UniProt

O94901 - SUN1_HUMAN

Protein

SUN domain-containing protein 1

Gene

SUN1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 134 (01 Oct 2014)
      Sequence version 3 (11 Jul 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of SUN-protein-containing multivariate complexes also called LINC complexes which link the nucleoskeleton and cytoskeleton by providing versatile outer nuclear membrane attachment sites for cytoskeletal filaments. Required for interkinetic nuclear migration (INM) and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration. Anchors chromosome movement in the prophase of meiosis and is involved in selective gene expression of coding and non-coding RNAs needed for gametogenesis. Required for telomere attachment to nuclear envelope and gametogenesis. Helps to define the distribution of nuclear pore complexes (NPCs) By similarity. Required for efficient localization of SYNE4 in the nuclear envelope By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. cytoskeletal anchoring at nuclear membrane Source: UniProtKB
    2. nuclear envelope organization Source: MGI
    3. nuclear matrix anchoring at nuclear membrane Source: UniProtKB

    Enzyme and pathway databases

    ReactomeiREACT_75792. Meiotic synapsis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    SUN domain-containing protein 1
    Alternative name(s):
    Protein unc-84 homolog A
    Sad1/unc-84 protein-like 1
    Gene namesi
    Name:SUN1
    Synonyms:KIAA0810, UNC84A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:18587. SUN1.

    Subcellular locationi

    Nucleus inner membrane 5 Publications; Single-pass type II membrane protein 5 Publications

    GO - Cellular componenti

    1. acrosomal membrane Source: Ensembl
    2. integral component of nuclear inner membrane Source: Ensembl
    3. nuclear envelope Source: UniProtKB
    4. SUN-KASH complex Source: UniProtKB

    Keywords - Cellular componenti

    Membrane, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA165618311.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 812812SUN domain-containing protein 1PRO_0000218911Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei100 – 1001Phosphoserine1 Publication
    Modified residuei138 – 1381Phosphoserine2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO94901.
    PaxDbiO94901.
    PRIDEiO94901.

    PTM databases

    PhosphoSiteiO94901.

    Expressioni

    Gene expression databases

    ArrayExpressiO94901.
    BgeeiO94901.
    CleanExiHS_UNC84A.
    GenevestigatoriO94901.

    Organism-specific databases

    HPAiHPA008346.
    HPA008461.

    Interactioni

    Subunit structurei

    Dimers and tetramers By similarity. Core component of the LINC complex which is composed of inner nuclear membrane SUN domain-containing proteins coupled to outer nuclear membrane KASH domain-containing nesprins. SUN domain-containing proteins interact with A-type lamins of the nuclear lamina, while at the other end of the complex, nesprins interact with unique cytoskeletal components. May interact with SYNE1, SYNE2 and SYNE3. May interact with SYNE4 By similarity. Interacts with A-type lamin with a strong preference for unprocessed A-type lamin compared with the mature protein. Interaction with lamins B1 and C is hardly detectable. Interacts with TSNAX By similarity. Interacts with EMD and NAT10. Associates with the nuclear pore complex (NPC) By similarity. Interacts with CCDC155 (via the last 22 AA); this interaction mediates CCDC155 telomere localization. Interacts with CCDC79/TERB1; promoting the accumulation of the LINC complex complexes at the telomere-nuclear envelope attachment sites By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    SYNE1Q8NF91-12EBI-2796904,EBI-6170938
    SYNE2Q8WXH0-12EBI-2796904,EBI-6170976

    Protein-protein interaction databases

    BioGridi116935. 7 interactions.
    IntActiO94901. 4 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliO94901.
    SMRiO94901. Positions 616-810.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 315315Nuclear1 PublicationAdd
    BLAST
    Topological domaini336 – 812477Perinuclear space1 PublicationAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei316 – 33520HelicalAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini649 – 811163SUNPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 138138LMNA-bindingAdd
    BLAST
    Regioni209 – 30294SYNE2-bindingAdd
    BLAST
    Regioni223 – 30280EMD-bindingAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili393 – 43038Sequence AnalysisAdd
    BLAST
    Coiled coili455 – 49339Sequence AnalysisAdd
    BLAST
    Coiled coili501 – 52323Sequence AnalysisAdd
    BLAST

    Domaini

    The SUN domain may play a role in the nuclear anchoring and/or migration.1 Publication

    Sequence similaritiesi

    Contains 1 SUN domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG285464.
    HOGENOMiHOG000253025.
    HOVERGENiHBG104132.
    OrthoDBiEOG7J446H.
    PhylomeDBiO94901.
    TreeFamiTF323915.

    Family and domain databases

    InterProiIPR012919. Sad1_UNC_C.
    IPR018539. SUN1.
    [Graphical view]
    PfamiPF09387. MRP. 2 hits.
    PF07738. Sad1_UNC. 1 hit.
    [Graphical view]
    PROSITEiPS51469. SUN. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O94901-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDFSRLHMYS PPQCVPENTG YTYALSSSYS SDALDFETEH KLDPVFDSPR    50
    MSRRSLRLAT TACTLGDGEA VGADSGTSSA VSLKNRAART TKQRRSTNKS 100
    AFSINHVSRQ VTSSGVSHGG TVSLQDAVTR RPPVLDESWI REQTTVDHFW 150
    GLDDDGDLKG GNKAAIQGNG DVGAAAATAH NGFSCSNCSM LSERKDVLTA 200
    HPAAPGPVSR VYSRDRNQKC DDCKGKRHLD AHPGRAGTLW HIWACAGYFL 250
    LQILRRIGAV GQAVSRTAWS ALWLAVVAPG KAASGVFWWL GIGWYQFVTL 300
    ISWLNVFLLT RCLRNICKFL VLLIPLFLLL AGLSLRGQGN FFSFLPVLNW 350
    ASMHRTQRVD DPQDVFKPTT SRLKQPLQGD SEAFPWHWMS GVEQQVASLS 400
    GQCHHHGENL RELTTLLQKL QARVDQMEGG AAGPSASVRD AVGQPPRETD 450
    FMAFHQEHEV RMSHLEDILG KLREKSEAIQ KELEQTKQKT ISAVGEQLLP 500
    TVEHLQLELD QLKSELSSWR HVKTGCETVD AVQERVDVQV REMVKLLFSE 550
    DQQGGSLEQL LQRFSSQFVS KGDLQTMLRD LQLQILRNVT HHVSVTKQLP 600
    TSEAVVSAVS EAGASGITEA QARAIVNSAL KLYSQDKTGM VDFALESGGG 650
    SILSTRCSET YETKTALMSL FGIPLWYFSQ SPRVVIQPDI YPGNCWAFKG 700
    SQGYLVVRLS MMIHPAAFTL EHIPKTLSPT GNISSAPKDF AVYGLENEYQ 750
    EEGQLLGQFT YDQDGESLQM FQALKRPDDT AFQIVELRIF SNWGHPEYTC 800
    LYRFRVHGEP VK 812
    Length:812
    Mass (Da):90,064
    Last modified:July 11, 2003 - v3
    Checksum:iB958E95510B6F15F
    GO
    Isoform 2 (identifier: O94901-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         221-257: DDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRI → KSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP
         258-812: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:257
    Mass (Da):28,083
    Checksum:i5E674FAF6714115C
    GO
    Isoform 3 (identifier: O94901-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         221-341: DDCKGKRHLD...GLSLRGQGNF → GASFYVNRIL...AVMLGTSSRE
         342-812: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:341
    Mass (Da):37,468
    Checksum:i144E6797A593A612
    GO
    Isoform 4 (identifier: O94901-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         109-109: R → V
         110-812: Missing.

    Show »
    Length:109
    Mass (Da):11,897
    Checksum:iED8ECECB9657080A
    GO
    Isoform 5 (identifier: O94901-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: Missing.
         220-280: CDDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPG → W

    Show »
    Length:702
    Mass (Da):77,911
    Checksum:i630DD5C326645BCE
    GO
    Isoform 6 (identifier: O94901-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         151-279: Missing.
         331-331: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:682
    Mass (Da):76,403
    Checksum:iCEEE24E27B0B6069
    GO
    Isoform 7 (identifier: O94901-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MGRISPGSPGLPRTVWFEVVNM
         221-257: DDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRI → KSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP
         258-812: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:278
    Mass (Da):30,365
    Checksum:iC4E91043C5F2C0BD
    GO
    Isoform 8 (identifier: O94901-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         221-247: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:785
    Mass (Da):87,110
    Checksum:i1099A50C9540ECF5
    GO
    Isoform 9 (identifier: O94901-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         219-219: K → KCGASFYVNR...GHLSVNGEAL
         232-232: H → HTAAHSQSPRL

    Note: No experimental confirmation available. Contains a phosphoserine at position 333.

    Show »
    Length:916
    Mass (Da):101,932
    Checksum:i3279C7C12D8613C0
    GO

    Sequence cautioni

    The sequence BAA34530.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti15 – 151V → A in CAD98070. (PubMed:17974005)Curated
    Sequence conflicti78 – 781S → G in CAD98070. (PubMed:17974005)Curated
    Sequence conflicti174 – 1741A → V in BAA34530. (PubMed:9872452)Curated
    Sequence conflicti204 – 2041A → P in AAH13613. (PubMed:15489334)Curated
    Sequence conflicti445 – 4451P → L in BAG51119. (PubMed:14702039)Curated
    Sequence conflicti503 – 5031E → K in BAG64069. (PubMed:14702039)Curated
    Sequence conflicti520 – 5201R → Q in BAG51119. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti118 – 1181H → Y.3 Publications
    Corresponds to variant rs6461378 [ dbSNP | Ensembl ].
    VAR_059828
    Natural varianti203 – 2031A → V.1 Publication
    Corresponds to variant rs144929525 [ dbSNP | Ensembl ].
    VAR_071065
    Natural varianti614 – 6141A → V.1 Publication
    VAR_071066

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5050Missing in isoform 5. 1 PublicationVSP_037867Add
    BLAST
    Alternative sequencei1 – 11M → MGRISPGSPGLPRTVWFEVV NM in isoform 7. 1 PublicationVSP_046108
    Alternative sequencei109 – 1091R → V in isoform 4. 1 PublicationVSP_007741
    Alternative sequencei110 – 812703Missing in isoform 4. 1 PublicationVSP_007742Add
    BLAST
    Alternative sequencei151 – 279129Missing in isoform 6. 1 PublicationVSP_045815Add
    BLAST
    Alternative sequencei219 – 2191K → KCGASFYVNRILWLARYTAS SFSSFLVQLFQVVLMKLSYE SENYKLKTHESKDCESESYK SKSHESKAHASYYGRMNVRE VLREDGHLSVNGEAL in isoform 9. CuratedVSP_047139
    Alternative sequencei220 – 28061CDDCK…VVAPG → W in isoform 5. 1 PublicationVSP_037868Add
    BLAST
    Alternative sequencei221 – 341121DDCKG…GQGNF → GASFYVNRILWLARYTASSF SSFLVQLFQVVLMKLSYESE NYKLKTHESKDCESESYKSK SHESKAHASYYGRMNVREVL REDGHLSVNGEALCKYGFVF LWASVVELVPHAVMLGTSSR E in isoform 3. 1 PublicationVSP_007745Add
    BLAST
    Alternative sequencei221 – 25737DDCKG…ILRRI → KSQSFKTQKKVCFPNLIFPF CKSQCLHYLSWRLKIIP in isoform 2 and isoform 7. 2 PublicationsVSP_007743Add
    BLAST
    Alternative sequencei221 – 24727Missing in isoform 8. 1 PublicationVSP_046269Add
    BLAST
    Alternative sequencei232 – 2321H → HTAAHSQSPRL in isoform 9. CuratedVSP_047140
    Alternative sequencei258 – 812555Missing in isoform 2 and isoform 7. 2 PublicationsVSP_007744Add
    BLAST
    Alternative sequencei331 – 3311Missing in isoform 6. 1 PublicationVSP_045816
    Alternative sequencei342 – 812471Missing in isoform 3. 1 PublicationVSP_007746Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB018353 mRNA. Translation: BAA34530.1. Different initiation.
    AK022469 mRNA. Translation: BAB14046.1.
    AK022816 mRNA. Translation: BAG51119.1.
    AK302896 mRNA. Translation: BAG64069.1.
    AK309120 mRNA. No translation available.
    BX538211 mRNA. Translation: CAD98070.1.
    AC073957 Genomic DNA. No translation available.
    AC099731 Genomic DNA. No translation available.
    BC013613 mRNA. Translation: AAH13613.1.
    BC142707 mRNA. Translation: AAI42708.1.
    AF202724 mRNA. Translation: AAF15888.1.
    CCDSiCCDS43533.1. [O94901-5]
    CCDS47525.1. [O94901-8]
    CCDS55078.1. [O94901-7]
    CCDS55079.1. [O94901-2]
    CCDS55080.1. [O94901-6]
    RefSeqiNP_001124437.1. NM_001130965.2. [O94901-8]
    NP_001165415.1. NM_001171944.1. [O94901-6]
    NP_001165416.1. NM_001171945.1. [O94901-7]
    NP_001165417.1. NM_001171946.1. [O94901-2]
    NP_079430.3. NM_025154.5. [O94901-5]
    UniGeneiHs.438072.

    Genome annotation databases

    EnsembliENST00000389574; ENSP00000374225; ENSG00000164828. [O94901-5]
    ENST00000401592; ENSP00000384015; ENSG00000164828. [O94901-8]
    ENST00000403868; ENSP00000383947; ENSG00000164828. [O94901-2]
    ENST00000425407; ENSP00000392309; ENSG00000164828. [O94901-5]
    ENST00000452783; ENSP00000413439; ENSG00000164828. [O94901-6]
    ENST00000457378; ENSP00000395952; ENSG00000164828. [O94901-7]
    GeneIDi23353.
    KEGGihsa:23353.
    UCSCiuc003sje.1. human. [O94901-3]
    uc003sjf.3. human. [O94901-5]
    uc003sjk.3. human. [O94901-1]
    uc021zyl.1. human. [O94901-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB018353 mRNA. Translation: BAA34530.1 . Different initiation.
    AK022469 mRNA. Translation: BAB14046.1 .
    AK022816 mRNA. Translation: BAG51119.1 .
    AK302896 mRNA. Translation: BAG64069.1 .
    AK309120 mRNA. No translation available.
    BX538211 mRNA. Translation: CAD98070.1 .
    AC073957 Genomic DNA. No translation available.
    AC099731 Genomic DNA. No translation available.
    BC013613 mRNA. Translation: AAH13613.1 .
    BC142707 mRNA. Translation: AAI42708.1 .
    AF202724 mRNA. Translation: AAF15888.1 .
    CCDSi CCDS43533.1. [O94901-5 ]
    CCDS47525.1. [O94901-8 ]
    CCDS55078.1. [O94901-7 ]
    CCDS55079.1. [O94901-2 ]
    CCDS55080.1. [O94901-6 ]
    RefSeqi NP_001124437.1. NM_001130965.2. [O94901-8 ]
    NP_001165415.1. NM_001171944.1. [O94901-6 ]
    NP_001165416.1. NM_001171945.1. [O94901-7 ]
    NP_001165417.1. NM_001171946.1. [O94901-2 ]
    NP_079430.3. NM_025154.5. [O94901-5 ]
    UniGenei Hs.438072.

    3D structure databases

    ProteinModelPortali O94901.
    SMRi O94901. Positions 616-810.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116935. 7 interactions.
    IntActi O94901. 4 interactions.

    PTM databases

    PhosphoSitei O94901.

    Proteomic databases

    MaxQBi O94901.
    PaxDbi O94901.
    PRIDEi O94901.

    Protocols and materials databases

    DNASUi 23353.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000389574 ; ENSP00000374225 ; ENSG00000164828 . [O94901-5 ]
    ENST00000401592 ; ENSP00000384015 ; ENSG00000164828 . [O94901-8 ]
    ENST00000403868 ; ENSP00000383947 ; ENSG00000164828 . [O94901-2 ]
    ENST00000425407 ; ENSP00000392309 ; ENSG00000164828 . [O94901-5 ]
    ENST00000452783 ; ENSP00000413439 ; ENSG00000164828 . [O94901-6 ]
    ENST00000457378 ; ENSP00000395952 ; ENSG00000164828 . [O94901-7 ]
    GeneIDi 23353.
    KEGGi hsa:23353.
    UCSCi uc003sje.1. human. [O94901-3 ]
    uc003sjf.3. human. [O94901-5 ]
    uc003sjk.3. human. [O94901-1 ]
    uc021zyl.1. human. [O94901-2 ]

    Organism-specific databases

    CTDi 23353.
    GeneCardsi GC07P000857.
    H-InvDB HIX0078880.
    HGNCi HGNC:18587. SUN1.
    HPAi HPA008346.
    HPA008461.
    MIMi 607723. gene.
    neXtProti NX_O94901.
    PharmGKBi PA165618311.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG285464.
    HOGENOMi HOG000253025.
    HOVERGENi HBG104132.
    OrthoDBi EOG7J446H.
    PhylomeDBi O94901.
    TreeFami TF323915.

    Enzyme and pathway databases

    Reactomei REACT_75792. Meiotic synapsis.

    Miscellaneous databases

    GeneWikii UNC84A.
    GenomeRNAii 23353.
    NextBioi 27033591.
    PROi O94901.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O94901.
    Bgeei O94901.
    CleanExi HS_UNC84A.
    Genevestigatori O94901.

    Family and domain databases

    InterProi IPR012919. Sad1_UNC_C.
    IPR018539. SUN1.
    [Graphical view ]
    Pfami PF09387. MRP. 2 hits.
    PF07738. Sad1_UNC. 1 hit.
    [Graphical view ]
    PROSITEi PS51469. SUN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-118.
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 5; 6 AND 7), VARIANT TYR-118.
      Tissue: Mammary gland, Substantia nigra and Testis.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Cerebellum.
    4. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 8), VARIANT TYR-118.
      Tissue: Ovary.
    6. "UNC-84 localizes to the nuclear envelope and is required for nuclear migration and anchoring during C. elegans development."
      Malone C.J., Fixsen W.D., Horvitz H.R., Han M.
      Development 126:3171-3181(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 389-812.
    7. "Nuclear membrane proteins with potential disease links found by subtractive proteomics."
      Schirmer E.C., Florens L., Guan T., Yates J.R. III, Gerace L.
      Science 301:1380-1382(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
    8. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-138, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Telomere anchoring at the nuclear periphery requires the budding yeast Sad1-UNC-84 domain protein Mps3."
      Bupp J.M., Martin A.E., Stensrud E.S., Jaspersen S.L.
      J. Cell Biol. 179:845-854(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH MPS3.
    10. "Characterization of the structures involved in localization of the SUN proteins to the nuclear envelope and the centrosome."
      Wang Q., Du X., Cai Z., Greene M.I.
      DNA Cell Biol. 25:554-562(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, SUBUNIT, ASSOCIATION WITH THE CENTROSOME.
    11. "Nuclear envelope localization of human UNC84A does not require nuclear lamins."
      Hasan S., Guttinger S., Muhlhausser P., Anderegg F., Burgler S., Kutay U.
      FEBS Lett. 580:1263-1268(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    12. "Histone acetyltransferase hALP and nuclear membrane protein hsSUN1 function in de-condensation of mitotic chromosomes."
      Chi Y.-H., Haller K., Peloponese J.-M. Jr., Jeang K.-T.
      J. Biol. Chem. 282:27447-27458(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH NAT10.
    13. Cited for: SUBCELLULAR LOCATION, TOPOLOGY, SUBUNIT, INTERACTION WITH SUN2.
    14. "Structural requirements for the assembly of LINC complexes and their function in cellular mechanical stiffness."
      Stewart-Hutchinson P.J., Hale C.M., Wirtz D., Hodzic D.
      Exp. Cell Res. 314:1892-1905(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SYNE1; SYNE2 AND SYNE3, FUNCTION OF THE LINC COMPLEXES.
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    16. "Mammalian SUN protein interaction networks at the inner nuclear membrane and their role in laminopathy disease processes."
      Haque F., Mazzeo D., Patel J.T., Smallwood D.T., Ellis J.A., Shanahan C.M., Shackleton S.
      J. Biol. Chem. 285:3487-3498(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, INTERACTION WITH EMD; LMNA AND SYNE2, DOMAIN, ASSOCIATION WITH THE NUCLEOSKELETON.
    17. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-100 AND SER-138, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-333 (ISOFORM 9), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    18. "Contribution of SUN1 mutations to the pathomechanism in muscular dystrophies."
      Li P., Meinke P., Huong Le T.T., Wehnert M., Noegel A.A.
      Hum. Mutat. 35:452-461(2014) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS VAL-203 AND VAL-614.

    Entry informationi

    Entry nameiSUN1_HUMAN
    AccessioniPrimary (citable) accession number: O94901
    Secondary accession number(s): A5PL20
    , B3KMV7, B4DZF7, B7WNY4, B7WP53, E9PDU4, E9PF23, F8WD13, Q96CZ7, Q9HA14, Q9UH98
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 2, 2002
    Last sequence update: July 11, 2003
    Last modified: October 1, 2014
    This is version 134 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3