O94901 (SUN1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SUN domain-containing protein 1 Alternative name(s): Protein unc-84 homolog A Sad1/unc-84 protein-like 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 812 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of SUN-protein-containing multivariate complexes also called LINC complexes which link the nucleoskeleton and cytoskeleton by providing versatile outer nuclear membrane attachment sites for cytoskeletal filaments. Required for interkinetic nuclear migration (INM) and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration. Anchors chromosome movement in the prophase of meiosis and is involved in selective gene expression of coding and non-coding RNAs needed for gametogenesis. Required for telomere attachment to nuclear envelope and gametogenesis. Helps to define the distribution of nuclear pore complexes (NPCs) By similarity. Ref.9 Ref.14 |
| Subunit structure | Dimers and tetramers By similarity. Component of LINC complexes composed of SUN domain-containing proteins SUN1 or SUN2 coupled to KASH domain-containing proteins (SYNE1, SYNE2 or SYNE3), also called nesprins. Interacts with TSNAX By similarity. Interacts with EMD, LMNA, NAT10, SYNE1, SYNE2 and SYNE3. Associates with the nuclear pore complex (NPC) By similarity. Interacts with CCDC155 (via the last 22 AA); this interaction mediates CCDC155 telomere localization By similarity. Ref.9 Ref.10 Ref.12 Ref.13 Ref.14 Ref.16 |
| Subcellular location | Nucleus inner membrane; Single-pass type II membrane protein Ref.7 Ref.10 Ref.11 Ref.13 Ref.16. |
| Domain | The SUN domain may play a role in the nuclear anchoring and/or migration. Ref.16 |
| Sequence similarities | Contains 1 SUN domain. |
| Sequence caution | The sequence BAA34530.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Signal-anchor Transmembrane Transmembrane helix |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cytoskeletal anchoring at nuclear membrane Inferred from direct assay Ref.14. Source: UniProtKB nuclear envelope organizationInferred from genetic interaction PubMed 16380439. Source: MGI nuclear matrix anchoring at nuclear membraneInferred from direct assay Ref.14. Source: UniProtKB |
| Cellular_component | SUN-KASH complex Inferred from direct assay Ref.14. Source: UniProtKB integral to membraneInferred from electronic annotation. Source: UniProtKB-KW nuclear inner membraneInferred from electronic annotation. Source: UniProtKB-SubCell nuclear membraneInferred from direct assay. Source: HPA |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| SYNE1 | Q8NF91-1 | 2 | EBI-2796904,EBI-6170938 | |
| SYNE2 | Q8WXH0-1 | 2 | EBI-2796904,EBI-6170976 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94901-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94901-2) The sequence of this isoform differs from the canonical sequence as follows: 221-257: DDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRI → KSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP 258-812: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O94901-3) The sequence of this isoform differs from the canonical sequence as follows: 221-341: DDCKGKRHLD...GLSLRGQGNF → GASFYVNRIL...AVMLGTSSRE 342-812: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O94901-4) The sequence of this isoform differs from the canonical sequence as follows: 109-109: R → V 110-812: Missing. | ||||||
| Isoform 5 (identifier: O94901-5) The sequence of this isoform differs from the canonical sequence as follows: 1-50: Missing. 220-280: CDDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPG → W | ||||||
| Isoform 6 (identifier: O94901-6) The sequence of this isoform differs from the canonical sequence as follows: 151-279: Missing. 331-331: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: O94901-7) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGRISPGSPGLPRTVWFEVVNM 221-257: DDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRI → KSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP 258-812: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 8 (identifier: O94901-8) The sequence of this isoform differs from the canonical sequence as follows: 221-247: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 812 | 812 | SUN domain-containing protein 1 | PRO_0000218911 | |||||
Regions | |||||||||
| Topological domain | 1 – 315 | 315 | Nuclear Ref.13 | ||||||
| Transmembrane | 316 – 335 | 20 | Helical | ||||||
| Topological domain | 336 – 812 | 477 | Perinuclear space Ref.13 | ||||||
| Domain | 649 – 811 | 163 | SUN | ||||||
| Region | 1 – 138 | 138 | LMNA-binding | ||||||
| Region | 209 – 302 | 94 | SYNE2-binding | ||||||
| Region | 223 – 302 | 80 | EMD-binding | ||||||
| Coiled coil | 393 – 430 | 38 | Potential | ||||||
| Coiled coil | 455 – 493 | 39 | Potential | ||||||
| Coiled coil | 501 – 523 | 23 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 48 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 52 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 100 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 138 | 1 | Phosphoserine Ref.8 Ref.17 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 50 | 50 | Missing in isoform 5. | VSP_037867 | |||||
| Alternative sequence | 1 | 1 | M → MGRISPGSPGLPRTVWFEVV NM in isoform 7. | VSP_046108 | |||||
| Alternative sequence | 109 | 1 | R → V in isoform 4. | VSP_007741 | |||||
| Alternative sequence | 110 – 812 | 703 | Missing in isoform 4. | VSP_007742 | |||||
| Alternative sequence | 151 – 279 | 129 | Missing in isoform 6. | VSP_045815 | |||||
| Alternative sequence | 220 – 280 | 61 | CDDCK…VVAPG → W in isoform 5. | VSP_037868 | |||||
| Alternative sequence | 221 – 341 | 121 | DDCKG…GQGNF → GASFYVNRILWLARYTASSF SSFLVQLFQVVLMKLSYESE NYKLKTHESKDCESESYKSK SHESKAHASYYGRMNVREVL REDGHLSVNGEALCKYGFVF LWASVVELVPHAVMLGTSSR E in isoform 3. | VSP_007745 | |||||
| Alternative sequence | 221 – 257 | 37 | DDCKG…ILRRI → KSQSFKTQKKVCFPNLIFPF CKSQCLHYLSWRLKIIP in isoform 2 and isoform 7. | VSP_007743 | |||||
| Alternative sequence | 221 – 247 | 27 | Missing in isoform 8. | VSP_046269 | |||||
| Alternative sequence | 258 – 812 | 555 | Missing in isoform 2 and isoform 7. | VSP_007744 | |||||
| Alternative sequence | 331 | 1 | Missing in isoform 6. | VSP_045816 | |||||
| Alternative sequence | 342 – 812 | 471 | Missing in isoform 3. | VSP_007746 | |||||
| Natural variant | 118 | 1 | H → Y. Ref.1 Ref.2 Ref.5 Corresponds to variant rs6461378 [ dbSNP | Ensembl ]. | VAR_059828 | |||||
Experimental info | |||||||||
| Sequence conflict | 15 | 1 | V → A in CAD98070. Ref.3 | ||||||
| Sequence conflict | 78 | 1 | S → G in CAD98070. Ref.3 | ||||||
| Sequence conflict | 174 | 1 | A → V in BAA34530. Ref.1 | ||||||
| Sequence conflict | 204 | 1 | A → P in AAH13613. Ref.5 | ||||||
| Sequence conflict | 445 | 1 | P → L in BAG51119. Ref.2 | ||||||
| Sequence conflict | 503 | 1 | E → K in BAG64069. Ref.2 | ||||||
| Sequence conflict | 520 | 1 | R → Q in BAG51119. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-118. Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 5; 6 AND 7), VARIANT TYR-118. Tissue: Mammary gland, Substantia nigra and Testis. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Cerebellum. |
| [4] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 8), VARIANT TYR-118. Tissue: Ovary. |
| [6] | "UNC-84 localizes to the nuclear envelope and is required for nuclear migration and anchoring during C. elegans development." Malone C.J., Fixsen W.D., Horvitz H.R., Han M. Development 126:3171-3181(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 389-812. |
| [7] | "Nuclear membrane proteins with potential disease links found by subtractive proteomics." Schirmer E.C., Florens L., Guan T., Yates J.R. III, Gerace L. Science 301:1380-1382(2003) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION. |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-138, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Telomere anchoring at the nuclear periphery requires the budding yeast Sad1-UNC-84 domain protein Mps3." Bupp J.M., Martin A.E., Stensrud E.S., Jaspersen S.L. J. Cell Biol. 179:845-854(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MPS3. |
| [10] | "Characterization of the structures involved in localization of the SUN proteins to the nuclear envelope and the centrosome." Wang Q., Du X., Cai Z., Greene M.I. DNA Cell Biol. 25:554-562(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, SUBUNIT, ASSOCIATION WITH THE CENTROSOME. |
| [11] | "Nuclear envelope localization of human UNC84A does not require nuclear lamins." Hasan S., Guttinger S., Muhlhausser P., Anderegg F., Burgler S., Kutay U. FEBS Lett. 580:1263-1268(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [12] | "Histone acetyltransferase hALP and nuclear membrane protein hsSUN1 function in de-condensation of mitotic chromosomes." Chi Y.-H., Haller K., Peloponese J.-M. Jr., Jeang K.-T. J. Biol. Chem. 282:27447-27458(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NAT10. |
| [13] | "Sun1 forms immobile macromolecular assemblies at the nuclear envelope." Lu W., Gotzmann J., Sironi L., Jaeger V.M., Schneider M., Luke Y., Uhlen M., Szigyarto C.A., Brachner A., Ellenberg J., Foisner R., Noegel A.A., Karakesisoglou I. Biochim. Biophys. Acta 1783:2415-2426(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TOPOLOGY, SUBUNIT, INTERACTION WITH SUN2. |
| [14] | "Structural requirements for the assembly of LINC complexes and their function in cellular mechanical stiffness." Stewart-Hutchinson P.J., Hale C.M., Wirtz D., Hodzic D. Exp. Cell Res. 314:1892-1905(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SYNE1; SYNE2 AND SYNE3, FUNCTION OF THE LINC COMPLEXES. |
| [15] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [16] | "Mammalian SUN protein interaction networks at the inner nuclear membrane and their role in laminopathy disease processes." Haque F., Mazzeo D., Patel J.T., Smallwood D.T., Ellis J.A., Shanahan C.M., Shackleton S. J. Biol. Chem. 285:3487-3498(2010) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH EMD; LMNA AND SYNE2, DOMAIN, ASSOCIATION WITH THE NUCLEOSKELETON. |
| [17] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-100 AND SER-138, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB018353 mRNA. Translation: BAA34530.1. Different initiation. AK022469 mRNA. Translation: BAB14046.1. AK022816 mRNA. Translation: BAG51119.1. AK302896 mRNA. Translation: BAG64069.1. AK309120 mRNA. No translation available. BX538211 mRNA. Translation: CAD98070.1. AC073957 Genomic DNA. No translation available. AC099731 Genomic DNA. No translation available. BC013613 mRNA. Translation: AAH13613.1. BC142707 mRNA. Translation: AAI42708.1. AF202724 mRNA. Translation: AAF15888.1. |
| IPI | IPI00306682. IPI00335367. IPI00409738. IPI00783943. IPI00873723. IPI00893282. IPI00894044. IPI00955411. |
| RefSeq | NP_001124437.1. NM_001130965.2. NP_001165415.1. NM_001171944.1. NP_001165416.1. NM_001171945.1. NP_001165417.1. NM_001171946.1. NP_079430.3. NM_025154.5. |
| UniGene | Hs.438072. |
3D structure databases | |
| ProteinModelPortal | O94901. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O94901. 4 interactions. |
PTM databases | |
| PhosphoSite | O94901. |
Proteomic databases | |
| PaxDb | O94901. |
| PRIDE | O94901. |
Protocols and materials databases | |
| DNASU | 23353. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000389574; ENSP00000374225; ENSG00000164828. ENST00000401592; ENSP00000384015; ENSG00000164828. ENST00000403868; ENSP00000383947; ENSG00000164828. ENST00000425407; ENSP00000392309; ENSG00000164828. ENST00000452783; ENSP00000413439; ENSG00000164828. ENST00000457378; ENSP00000395952; ENSG00000164828. |
| GeneID | 23353. |
| KEGG | hsa:23353. |
| UCSC | uc003sje.1. human. uc003sjf.3. human. uc003sjk.3. human. uc010ksa.1. human. uc011jvq.2. human. uc021zyl.1. human. uc021zym.1. human. |
Organism-specific databases | |
| CTD | 23353. |
| GeneCards | GC07P000857. |
| H-InvDB | HIX0078880. |
| HGNC | HGNC:18587. SUN1. |
| HPA | HPA008346. HPA008461. |
| MIM | 607723. gene. |
| neXtProt | NX_O94901. |
| PharmGKB | PA165618311. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG285464. |
| HOGENOM | HOG000253025. |
| HOVERGEN | HBG104132. |
| OrthoDB | EOG447FSW. |
Enzyme and pathway databases | |
| Reactome | REACT_111183. Meiosis. REACT_115566. Cell Cycle. |
Gene expression databases | |
| ArrayExpress | O94901. |
| Bgee | O94901. |
| CleanEx | HS_UNC84A. |
| Genevestigator | O94901. |
| GermOnline | ENSG00000164828. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR018539. RNA-bd_mt. IPR012919. Sad1_UNC_C. [Graphical view] |
| Pfam | PF09387. MRP. 2 hits. PF07738. Sad1_UNC. 1 hit. [Graphical view] |
| PROSITE | PS51469. SUN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 23353. |
| NextBio | 27033591. |
| SOURCE | Search... |
Entry information
| Entry name | SUN1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94901 Secondary accession number(s): A5PL20 Q9UH98 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
