Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O94901 (SUN1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 129. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
SUN domain-containing protein 1
Alternative name(s):
Protein unc-84 homolog A
Sad1/unc-84 protein-like 1
Gene names
Name:SUN1
Synonyms:KIAA0810, UNC84A
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length812 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Component of SUN-protein-containing multivariate complexes also called LINC complexes which link the nucleoskeleton and cytoskeleton by providing versatile outer nuclear membrane attachment sites for cytoskeletal filaments. Required for interkinetic nuclear migration (INM) and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration. Anchors chromosome movement in the prophase of meiosis and is involved in selective gene expression of coding and non-coding RNAs needed for gametogenesis. Required for telomere attachment to nuclear envelope and gametogenesis. Helps to define the distribution of nuclear pore complexes (NPCs) By similarity. Required for efficient localization of SYNE4 in the nuclear envelope By similarity. Ref.9 Ref.14

Subunit structure

Dimers and tetramers By similarity. Core component of the LINC complex which is composed of inner nuclear membrane SUN domain-containing proteins coupled to outer nuclear membrane KASH domain-containing nesprins. SUN domain-containing proteins interact with A-type lamins of the nuclear lamina, while at the other end of the complex, nesprins interact with unique cytoskeletal components. May interact with SYNE1, SYNE2 and SYNE3. May interact with SYNE4 By similarity. Interacts with A-type lamin with a strong preference for unprocessed A-type lamin compared with the mature protein. Interaction with lamins B1 and C is hardly detectable. Interacts with TSNAX By similarity. Interacts with EMD and NAT10. Associates with the nuclear pore complex (NPC) By similarity. Interacts with CCDC155 (via the last 22 AA); this interaction mediates CCDC155 telomere localization. Interacts with CCDC79/TERB1; promoting the accumulation of the LINC complex complexes at the telomere-nuclear envelope attachment sites By similarity. Ref.9 Ref.10 Ref.12 Ref.13 Ref.14 Ref.16

Subcellular location

Nucleus inner membrane; Single-pass type II membrane protein Ref.7 Ref.10 Ref.11 Ref.13 Ref.16.

Domain

The SUN domain may play a role in the nuclear anchoring and/or migration. Ref.16

Sequence similarities

Contains 1 SUN domain.

Sequence caution

The sequence BAA34530.1 differs from that shown. Reason: Erroneous initiation.

Binary interactions

Alternative products

This entry describes 9 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O94901-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O94901-2)

The sequence of this isoform differs from the canonical sequence as follows:
     221-257: DDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRI → KSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP
     258-812: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: O94901-3)

The sequence of this isoform differs from the canonical sequence as follows:
     221-341: DDCKGKRHLD...GLSLRGQGNF → GASFYVNRIL...AVMLGTSSRE
     342-812: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: O94901-4)

The sequence of this isoform differs from the canonical sequence as follows:
     109-109: R → V
     110-812: Missing.
Isoform 5 (identifier: O94901-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.
     220-280: CDDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPG → W
Isoform 6 (identifier: O94901-6)

The sequence of this isoform differs from the canonical sequence as follows:
     151-279: Missing.
     331-331: Missing.
Note: No experimental confirmation available.
Isoform 7 (identifier: O94901-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGRISPGSPGLPRTVWFEVVNM
     221-257: DDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRI → KSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP
     258-812: Missing.
Note: No experimental confirmation available.
Isoform 8 (identifier: O94901-8)

The sequence of this isoform differs from the canonical sequence as follows:
     221-247: Missing.
Note: No experimental confirmation available.
Isoform 9 (identifier: O94901-9)

The sequence of this isoform differs from the canonical sequence as follows:
     219-219: K → KCGASFYVNR...GHLSVNGEAL
     232-232: H → HTAAHSQSPRL
Note: No experimental confirmation available. Contains a phosphoserine at position 333.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 812812SUN domain-containing protein 1
PRO_0000218911

Regions

Topological domain1 – 315315Nuclear Ref.13
Transmembrane316 – 33520Helical
Topological domain336 – 812477Perinuclear space Ref.13
Domain649 – 811163SUN
Region1 – 138138LMNA-binding
Region209 – 30294SYNE2-binding
Region223 – 30280EMD-binding
Coiled coil393 – 43038 Potential
Coiled coil455 – 49339 Potential
Coiled coil501 – 52323 Potential

Amino acid modifications

Modified residue1001Phosphoserine Ref.17
Modified residue1381Phosphoserine Ref.8 Ref.17

Natural variations

Alternative sequence1 – 5050Missing in isoform 5.
VSP_037867
Alternative sequence11M → MGRISPGSPGLPRTVWFEVV NM in isoform 7.
VSP_046108
Alternative sequence1091R → V in isoform 4.
VSP_007741
Alternative sequence110 – 812703Missing in isoform 4.
VSP_007742
Alternative sequence151 – 279129Missing in isoform 6.
VSP_045815
Alternative sequence2191K → KCGASFYVNRILWLARYTAS SFSSFLVQLFQVVLMKLSYE SENYKLKTHESKDCESESYK SKSHESKAHASYYGRMNVRE VLREDGHLSVNGEAL in isoform 9.
VSP_047139
Alternative sequence220 – 28061CDDCK…VVAPG → W in isoform 5.
VSP_037868
Alternative sequence221 – 341121DDCKG…GQGNF → GASFYVNRILWLARYTASSF SSFLVQLFQVVLMKLSYESE NYKLKTHESKDCESESYKSK SHESKAHASYYGRMNVREVL REDGHLSVNGEALCKYGFVF LWASVVELVPHAVMLGTSSR E in isoform 3.
VSP_007745
Alternative sequence221 – 25737DDCKG…ILRRI → KSQSFKTQKKVCFPNLIFPF CKSQCLHYLSWRLKIIP in isoform 2 and isoform 7.
VSP_007743
Alternative sequence221 – 24727Missing in isoform 8.
VSP_046269
Alternative sequence2321H → HTAAHSQSPRL in isoform 9.
VSP_047140
Alternative sequence258 – 812555Missing in isoform 2 and isoform 7.
VSP_007744
Alternative sequence3311Missing in isoform 6.
VSP_045816
Alternative sequence342 – 812471Missing in isoform 3.
VSP_007746
Natural variant1181H → Y. Ref.1 Ref.2 Ref.5
Corresponds to variant rs6461378 [ dbSNP | Ensembl ].
VAR_059828

Experimental info

Sequence conflict151V → A in CAD98070. Ref.3
Sequence conflict781S → G in CAD98070. Ref.3
Sequence conflict1741A → V in BAA34530. Ref.1
Sequence conflict2041A → P in AAH13613. Ref.5
Sequence conflict4451P → L in BAG51119. Ref.2
Sequence conflict5031E → K in BAG64069. Ref.2
Sequence conflict5201R → Q in BAG51119. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 11, 2003. Version 3.
Checksum: B958E95510B6F15F

FASTA81290,064
        10         20         30         40         50         60 
MDFSRLHMYS PPQCVPENTG YTYALSSSYS SDALDFETEH KLDPVFDSPR MSRRSLRLAT 

        70         80         90        100        110        120 
TACTLGDGEA VGADSGTSSA VSLKNRAART TKQRRSTNKS AFSINHVSRQ VTSSGVSHGG 

       130        140        150        160        170        180 
TVSLQDAVTR RPPVLDESWI REQTTVDHFW GLDDDGDLKG GNKAAIQGNG DVGAAAATAH 

       190        200        210        220        230        240 
NGFSCSNCSM LSERKDVLTA HPAAPGPVSR VYSRDRNQKC DDCKGKRHLD AHPGRAGTLW 

       250        260        270        280        290        300 
HIWACAGYFL LQILRRIGAV GQAVSRTAWS ALWLAVVAPG KAASGVFWWL GIGWYQFVTL 

       310        320        330        340        350        360 
ISWLNVFLLT RCLRNICKFL VLLIPLFLLL AGLSLRGQGN FFSFLPVLNW ASMHRTQRVD 

       370        380        390        400        410        420 
DPQDVFKPTT SRLKQPLQGD SEAFPWHWMS GVEQQVASLS GQCHHHGENL RELTTLLQKL 

       430        440        450        460        470        480 
QARVDQMEGG AAGPSASVRD AVGQPPRETD FMAFHQEHEV RMSHLEDILG KLREKSEAIQ 

       490        500        510        520        530        540 
KELEQTKQKT ISAVGEQLLP TVEHLQLELD QLKSELSSWR HVKTGCETVD AVQERVDVQV 

       550        560        570        580        590        600 
REMVKLLFSE DQQGGSLEQL LQRFSSQFVS KGDLQTMLRD LQLQILRNVT HHVSVTKQLP 

       610        620        630        640        650        660 
TSEAVVSAVS EAGASGITEA QARAIVNSAL KLYSQDKTGM VDFALESGGG SILSTRCSET 

       670        680        690        700        710        720 
YETKTALMSL FGIPLWYFSQ SPRVVIQPDI YPGNCWAFKG SQGYLVVRLS MMIHPAAFTL 

       730        740        750        760        770        780 
EHIPKTLSPT GNISSAPKDF AVYGLENEYQ EEGQLLGQFT YDQDGESLQM FQALKRPDDT 

       790        800        810 
AFQIVELRIF SNWGHPEYTC LYRFRVHGEP VK 

« Hide

Isoform 2 [UniParc].

Checksum: 5E674FAF6714115C
Show »

FASTA25728,083
Isoform 3 [UniParc].

Checksum: 144E6797A593A612
Show »

FASTA34137,468
Isoform 4 [UniParc].

Checksum: ED8ECECB9657080A
Show »

FASTA10911,897
Isoform 5 [UniParc].

Checksum: 630DD5C326645BCE
Show »

FASTA70277,911
Isoform 6 [UniParc].

Checksum: CEEE24E27B0B6069
Show »

FASTA68276,403
Isoform 7 [UniParc].

Checksum: C4E91043C5F2C0BD
Show »

FASTA27830,365
Isoform 8 [UniParc].

Checksum: 1099A50C9540ECF5
Show »

FASTA78587,110
Isoform 9 [UniParc].

Checksum: 3279C7C12D8613C0
Show »

FASTA916101,932

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-118.
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 5; 6 AND 7), VARIANT TYR-118.
Tissue: Mammary gland, Substantia nigra and Testis.
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Cerebellum.
[4]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 8), VARIANT TYR-118.
Tissue: Ovary.
[6]"UNC-84 localizes to the nuclear envelope and is required for nuclear migration and anchoring during C. elegans development."
Malone C.J., Fixsen W.D., Horvitz H.R., Han M.
Development 126:3171-3181(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 389-812.
[7]"Nuclear membrane proteins with potential disease links found by subtractive proteomics."
Schirmer E.C., Florens L., Guan T., Yates J.R. III, Gerace L.
Science 301:1380-1382(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
[8]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-138, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"Telomere anchoring at the nuclear periphery requires the budding yeast Sad1-UNC-84 domain protein Mps3."
Bupp J.M., Martin A.E., Stensrud E.S., Jaspersen S.L.
J. Cell Biol. 179:845-854(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH MPS3.
[10]"Characterization of the structures involved in localization of the SUN proteins to the nuclear envelope and the centrosome."
Wang Q., Du X., Cai Z., Greene M.I.
DNA Cell Biol. 25:554-562(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, SUBUNIT, ASSOCIATION WITH THE CENTROSOME.
[11]"Nuclear envelope localization of human UNC84A does not require nuclear lamins."
Hasan S., Guttinger S., Muhlhausser P., Anderegg F., Burgler S., Kutay U.
FEBS Lett. 580:1263-1268(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
[12]"Histone acetyltransferase hALP and nuclear membrane protein hsSUN1 function in de-condensation of mitotic chromosomes."
Chi Y.-H., Haller K., Peloponese J.-M. Jr., Jeang K.-T.
J. Biol. Chem. 282:27447-27458(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH NAT10.
[13]"Sun1 forms immobile macromolecular assemblies at the nuclear envelope."
Lu W., Gotzmann J., Sironi L., Jaeger V.M., Schneider M., Luke Y., Uhlen M., Szigyarto C.A., Brachner A., Ellenberg J., Foisner R., Noegel A.A., Karakesisoglou I.
Biochim. Biophys. Acta 1783:2415-2426(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, TOPOLOGY, SUBUNIT, INTERACTION WITH SUN2.
[14]"Structural requirements for the assembly of LINC complexes and their function in cellular mechanical stiffness."
Stewart-Hutchinson P.J., Hale C.M., Wirtz D., Hodzic D.
Exp. Cell Res. 314:1892-1905(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH SYNE1; SYNE2 AND SYNE3, FUNCTION OF THE LINC COMPLEXES.
[15]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[16]"Mammalian SUN protein interaction networks at the inner nuclear membrane and their role in laminopathy disease processes."
Haque F., Mazzeo D., Patel J.T., Smallwood D.T., Ellis J.A., Shanahan C.M., Shackleton S.
J. Biol. Chem. 285:3487-3498(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, INTERACTION WITH EMD; LMNA AND SYNE2, DOMAIN, ASSOCIATION WITH THE NUCLEOSKELETON.
[17]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-100 AND SER-138, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-333 (ISOFORM 9), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB018353 mRNA. Translation: BAA34530.1. Different initiation.
AK022469 mRNA. Translation: BAB14046.1.
AK022816 mRNA. Translation: BAG51119.1.
AK302896 mRNA. Translation: BAG64069.1.
AK309120 mRNA. No translation available.
BX538211 mRNA. Translation: CAD98070.1.
AC073957 Genomic DNA. No translation available.
AC099731 Genomic DNA. No translation available.
BC013613 mRNA. Translation: AAH13613.1.
BC142707 mRNA. Translation: AAI42708.1.
AF202724 mRNA. Translation: AAF15888.1.
RefSeqNP_001124437.1. NM_001130965.2.
NP_001165415.1. NM_001171944.1.
NP_001165416.1. NM_001171945.1.
NP_001165417.1. NM_001171946.1.
NP_079430.3. NM_025154.5.
UniGeneHs.438072.

3D structure databases

ProteinModelPortalO94901.
SMRO94901. Positions 616-810.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116935. 5 interactions.
IntActO94901. 4 interactions.

PTM databases

PhosphoSiteO94901.

Proteomic databases

PaxDbO94901.
PRIDEO94901.

Protocols and materials databases

DNASU23353.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000389574; ENSP00000374225; ENSG00000164828. [O94901-5]
ENST00000401592; ENSP00000384015; ENSG00000164828. [O94901-8]
ENST00000403868; ENSP00000383947; ENSG00000164828. [O94901-2]
ENST00000425407; ENSP00000392309; ENSG00000164828. [O94901-5]
ENST00000452783; ENSP00000413439; ENSG00000164828. [O94901-6]
ENST00000457378; ENSP00000395952; ENSG00000164828. [O94901-7]
GeneID23353.
KEGGhsa:23353.
UCSCuc003sje.1. human. [O94901-3]
uc003sjf.3. human. [O94901-5]
uc003sjk.3. human. [O94901-1]
uc021zyl.1. human. [O94901-2]

Organism-specific databases

CTD23353.
GeneCardsGC07P000857.
H-InvDBHIX0078880.
HGNCHGNC:18587. SUN1.
HPAHPA008346.
HPA008461.
MIM607723. gene.
neXtProtNX_O94901.
PharmGKBPA165618311.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG285464.
HOGENOMHOG000253025.
HOVERGENHBG104132.
OrthoDBEOG7J446H.
PhylomeDBO94901.
TreeFamTF323915.

Enzyme and pathway databases

ReactomeREACT_111183. Meiosis.
REACT_115566. Cell Cycle.

Gene expression databases

ArrayExpressO94901.
BgeeO94901.
CleanExHS_UNC84A.
GenevestigatorO94901.

Family and domain databases

InterProIPR012919. Sad1_UNC_C.
IPR018539. SUN1.
[Graphical view]
PfamPF09387. MRP. 2 hits.
PF07738. Sad1_UNC. 1 hit.
[Graphical view]
PROSITEPS51469. SUN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiUNC84A.
GenomeRNAi23353.
NextBio27033591.
PROO94901.
SOURCESearch...

Entry information

Entry nameSUN1_HUMAN
AccessionPrimary (citable) accession number: O94901
Secondary accession number(s): A5PL20 expand/collapse secondary AC list , B3KMV7, B4DZF7, B7WNY4, B7WP53, E9PDU4, E9PF23, F8WD13, Q96CZ7, Q9HA14, Q9UH98
Entry history
Integrated into UniProtKB/Swiss-Prot: August 2, 2002
Last sequence update: July 11, 2003
Last modified: April 16, 2014
This is version 129 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM