SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O94901

- SUN1_HUMAN

UniProt

O94901 - SUN1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
SUN domain-containing protein 1
Gene
SUN1, KIAA0810, UNC84A
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Component of SUN-protein-containing multivariate complexes also called LINC complexes which link the nucleoskeleton and cytoskeleton by providing versatile outer nuclear membrane attachment sites for cytoskeletal filaments. Required for interkinetic nuclear migration (INM) and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration. Anchors chromosome movement in the prophase of meiosis and is involved in selective gene expression of coding and non-coding RNAs needed for gametogenesis. Required for telomere attachment to nuclear envelope and gametogenesis. Helps to define the distribution of nuclear pore complexes (NPCs) By similarity. Required for efficient localization of SYNE4 in the nuclear envelope By similarity.2 Publications

GO - Molecular functioni

  1. protein binding Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. cytoskeletal anchoring at nuclear membrane Source: UniProtKB
  2. nuclear envelope organization Source: MGI
  3. nuclear matrix anchoring at nuclear membrane Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_75792. Meiotic synapsis.

Names & Taxonomyi

Protein namesi
Recommended name:
SUN domain-containing protein 1
Alternative name(s):
Protein unc-84 homolog A
Sad1/unc-84 protein-like 1
Gene namesi
Name:SUN1
Synonyms:KIAA0810, UNC84A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:18587. SUN1.

Subcellular locationi

Nucleus inner membrane; Single-pass type II membrane protein 5 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 315315Nuclear1 Publication
Add
BLAST
Transmembranei316 – 33520Helical
Add
BLAST
Topological domaini336 – 812477Perinuclear space1 Publication
Add
BLAST

GO - Cellular componenti

  1. SUN-KASH complex Source: UniProtKB
  2. acrosomal membrane Source: Ensembl
  3. integral component of nuclear inner membrane Source: Ensembl
  4. nuclear envelope Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165618311.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 812812SUN domain-containing protein 1
PRO_0000218911Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei100 – 1001Phosphoserine1 Publication
Modified residuei138 – 1381Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO94901.
PaxDbiO94901.
PRIDEiO94901.

PTM databases

PhosphoSiteiO94901.

Expressioni

Gene expression databases

ArrayExpressiO94901.
BgeeiO94901.
CleanExiHS_UNC84A.
GenevestigatoriO94901.

Organism-specific databases

HPAiHPA008346.
HPA008461.

Interactioni

Subunit structurei

Dimers and tetramers By similarity. Core component of the LINC complex which is composed of inner nuclear membrane SUN domain-containing proteins coupled to outer nuclear membrane KASH domain-containing nesprins. SUN domain-containing proteins interact with A-type lamins of the nuclear lamina, while at the other end of the complex, nesprins interact with unique cytoskeletal components. May interact with SYNE1, SYNE2 and SYNE3. May interact with SYNE4 By similarity. Interacts with A-type lamin with a strong preference for unprocessed A-type lamin compared with the mature protein. Interaction with lamins B1 and C is hardly detectable. Interacts with TSNAX By similarity. Interacts with EMD and NAT10. Associates with the nuclear pore complex (NPC) By similarity. Interacts with CCDC155 (via the last 22 AA); this interaction mediates CCDC155 telomere localization. Interacts with CCDC79/TERB1; promoting the accumulation of the LINC complex complexes at the telomere-nuclear envelope attachment sites By similarity.6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
SYNE1Q8NF91-12EBI-2796904,EBI-6170938
SYNE2Q8WXH0-12EBI-2796904,EBI-6170976

Protein-protein interaction databases

BioGridi116935. 7 interactions.
IntActiO94901. 4 interactions.

Structurei

3D structure databases

ProteinModelPortaliO94901.
SMRiO94901. Positions 616-810.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini649 – 811163SUN
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 138138LMNA-binding
Add
BLAST
Regioni209 – 30294SYNE2-binding
Add
BLAST
Regioni223 – 30280EMD-binding
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili393 – 43038 Reviewed prediction
Add
BLAST
Coiled coili455 – 49339 Reviewed prediction
Add
BLAST
Coiled coili501 – 52323 Reviewed prediction
Add
BLAST

Domaini

The SUN domain may play a role in the nuclear anchoring and/or migration.1 Publication

Sequence similaritiesi

Contains 1 SUN domain.

Keywords - Domaini

Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG285464.
HOGENOMiHOG000253025.
HOVERGENiHBG104132.
OrthoDBiEOG7J446H.
PhylomeDBiO94901.
TreeFamiTF323915.

Family and domain databases

InterProiIPR012919. Sad1_UNC_C.
IPR018539. SUN1.
[Graphical view]
PfamiPF09387. MRP. 2 hits.
PF07738. Sad1_UNC. 1 hit.
[Graphical view]
PROSITEiPS51469. SUN. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O94901-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDFSRLHMYS PPQCVPENTG YTYALSSSYS SDALDFETEH KLDPVFDSPR    50
MSRRSLRLAT TACTLGDGEA VGADSGTSSA VSLKNRAART TKQRRSTNKS 100
AFSINHVSRQ VTSSGVSHGG TVSLQDAVTR RPPVLDESWI REQTTVDHFW 150
GLDDDGDLKG GNKAAIQGNG DVGAAAATAH NGFSCSNCSM LSERKDVLTA 200
HPAAPGPVSR VYSRDRNQKC DDCKGKRHLD AHPGRAGTLW HIWACAGYFL 250
LQILRRIGAV GQAVSRTAWS ALWLAVVAPG KAASGVFWWL GIGWYQFVTL 300
ISWLNVFLLT RCLRNICKFL VLLIPLFLLL AGLSLRGQGN FFSFLPVLNW 350
ASMHRTQRVD DPQDVFKPTT SRLKQPLQGD SEAFPWHWMS GVEQQVASLS 400
GQCHHHGENL RELTTLLQKL QARVDQMEGG AAGPSASVRD AVGQPPRETD 450
FMAFHQEHEV RMSHLEDILG KLREKSEAIQ KELEQTKQKT ISAVGEQLLP 500
TVEHLQLELD QLKSELSSWR HVKTGCETVD AVQERVDVQV REMVKLLFSE 550
DQQGGSLEQL LQRFSSQFVS KGDLQTMLRD LQLQILRNVT HHVSVTKQLP 600
TSEAVVSAVS EAGASGITEA QARAIVNSAL KLYSQDKTGM VDFALESGGG 650
SILSTRCSET YETKTALMSL FGIPLWYFSQ SPRVVIQPDI YPGNCWAFKG 700
SQGYLVVRLS MMIHPAAFTL EHIPKTLSPT GNISSAPKDF AVYGLENEYQ 750
EEGQLLGQFT YDQDGESLQM FQALKRPDDT AFQIVELRIF SNWGHPEYTC 800
LYRFRVHGEP VK 812
Length:812
Mass (Da):90,064
Last modified:July 11, 2003 - v3
Checksum:iB958E95510B6F15F
GO
Isoform 2 (identifier: O94901-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     221-257: DDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRI → KSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP
     258-812: Missing.

Note: No experimental confirmation available.

Show »
Length:257
Mass (Da):28,083
Checksum:i5E674FAF6714115C
GO
Isoform 3 (identifier: O94901-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     221-341: DDCKGKRHLD...GLSLRGQGNF → GASFYVNRIL...AVMLGTSSRE
     342-812: Missing.

Note: No experimental confirmation available.

Show »
Length:341
Mass (Da):37,468
Checksum:i144E6797A593A612
GO
Isoform 4 (identifier: O94901-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-109: R → V
     110-812: Missing.

Show »
Length:109
Mass (Da):11,897
Checksum:iED8ECECB9657080A
GO
Isoform 5 (identifier: O94901-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.
     220-280: CDDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPG → W

Show »
Length:702
Mass (Da):77,911
Checksum:i630DD5C326645BCE
GO
Isoform 6 (identifier: O94901-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     151-279: Missing.
     331-331: Missing.

Note: No experimental confirmation available.

Show »
Length:682
Mass (Da):76,403
Checksum:iCEEE24E27B0B6069
GO
Isoform 7 (identifier: O94901-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGRISPGSPGLPRTVWFEVVNM
     221-257: DDCKGKRHLDAHPGRAGTLWHIWACAGYFLLQILRRI → KSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP
     258-812: Missing.

Note: No experimental confirmation available.

Show »
Length:278
Mass (Da):30,365
Checksum:iC4E91043C5F2C0BD
GO
Isoform 8 (identifier: O94901-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     221-247: Missing.

Note: No experimental confirmation available.

Show »
Length:785
Mass (Da):87,110
Checksum:i1099A50C9540ECF5
GO
Isoform 9 (identifier: O94901-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     219-219: K → KCGASFYVNR...GHLSVNGEAL
     232-232: H → HTAAHSQSPRL

Note: No experimental confirmation available. Contains a phosphoserine at position 333.

Show »
Length:916
Mass (Da):101,932
Checksum:i3279C7C12D8613C0
GO

Sequence cautioni

The sequence BAA34530.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti118 – 1181H → Y.3 Publications
Corresponds to variant rs6461378 [ dbSNP | Ensembl ].
VAR_059828
Natural varianti203 – 2031A → V.
Corresponds to variant rs144929525 [ dbSNP | Ensembl ].
VAR_071065
Natural varianti614 – 6141A → V.
VAR_071066

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5050Missing in isoform 5.
VSP_037867Add
BLAST
Alternative sequencei1 – 11M → MGRISPGSPGLPRTVWFEVV NM in isoform 7.
VSP_046108
Alternative sequencei109 – 1091R → V in isoform 4.
VSP_007741
Alternative sequencei110 – 812703Missing in isoform 4.
VSP_007742Add
BLAST
Alternative sequencei151 – 279129Missing in isoform 6.
VSP_045815Add
BLAST
Alternative sequencei219 – 2191K → KCGASFYVNRILWLARYTAS SFSSFLVQLFQVVLMKLSYE SENYKLKTHESKDCESESYK SKSHESKAHASYYGRMNVRE VLREDGHLSVNGEAL in isoform 9.
VSP_047139
Alternative sequencei220 – 28061CDDCK…VVAPG → W in isoform 5.
VSP_037868Add
BLAST
Alternative sequencei221 – 341121DDCKG…GQGNF → GASFYVNRILWLARYTASSF SSFLVQLFQVVLMKLSYESE NYKLKTHESKDCESESYKSK SHESKAHASYYGRMNVREVL REDGHLSVNGEALCKYGFVF LWASVVELVPHAVMLGTSSR E in isoform 3.
VSP_007745Add
BLAST
Alternative sequencei221 – 25737DDCKG…ILRRI → KSQSFKTQKKVCFPNLIFPF CKSQCLHYLSWRLKIIP in isoform 2 and isoform 7.
VSP_007743Add
BLAST
Alternative sequencei221 – 24727Missing in isoform 8.
VSP_046269Add
BLAST
Alternative sequencei232 – 2321H → HTAAHSQSPRL in isoform 9.
VSP_047140
Alternative sequencei258 – 812555Missing in isoform 2 and isoform 7.
VSP_007744Add
BLAST
Alternative sequencei331 – 3311Missing in isoform 6.
VSP_045816
Alternative sequencei342 – 812471Missing in isoform 3.
VSP_007746Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti15 – 151V → A in CAD98070. 1 Publication
Sequence conflicti78 – 781S → G in CAD98070. 1 Publication
Sequence conflicti174 – 1741A → V in BAA34530. 1 Publication
Sequence conflicti204 – 2041A → P in AAH13613. 1 Publication
Sequence conflicti445 – 4451P → L in BAG51119. 1 Publication
Sequence conflicti503 – 5031E → K in BAG64069. 1 Publication
Sequence conflicti520 – 5201R → Q in BAG51119. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB018353 mRNA. Translation: BAA34530.1. Different initiation.
AK022469 mRNA. Translation: BAB14046.1.
AK022816 mRNA. Translation: BAG51119.1.
AK302896 mRNA. Translation: BAG64069.1.
AK309120 mRNA. No translation available.
BX538211 mRNA. Translation: CAD98070.1.
AC073957 Genomic DNA. No translation available.
AC099731 Genomic DNA. No translation available.
BC013613 mRNA. Translation: AAH13613.1.
BC142707 mRNA. Translation: AAI42708.1.
AF202724 mRNA. Translation: AAF15888.1.
CCDSiCCDS43533.1. [O94901-5]
CCDS47525.1. [O94901-8]
CCDS55078.1. [O94901-7]
CCDS55079.1. [O94901-2]
CCDS55080.1. [O94901-6]
RefSeqiNP_001124437.1. NM_001130965.2. [O94901-8]
NP_001165415.1. NM_001171944.1. [O94901-6]
NP_001165416.1. NM_001171945.1. [O94901-7]
NP_001165417.1. NM_001171946.1. [O94901-2]
NP_079430.3. NM_025154.5. [O94901-5]
UniGeneiHs.438072.

Genome annotation databases

EnsembliENST00000389574; ENSP00000374225; ENSG00000164828. [O94901-5]
ENST00000401592; ENSP00000384015; ENSG00000164828. [O94901-8]
ENST00000403868; ENSP00000383947; ENSG00000164828. [O94901-2]
ENST00000425407; ENSP00000392309; ENSG00000164828. [O94901-5]
ENST00000452783; ENSP00000413439; ENSG00000164828. [O94901-6]
ENST00000457378; ENSP00000395952; ENSG00000164828. [O94901-7]
GeneIDi23353.
KEGGihsa:23353.
UCSCiuc003sje.1. human. [O94901-3]
uc003sjf.3. human. [O94901-5]
uc003sjk.3. human. [O94901-1]
uc021zyl.1. human. [O94901-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB018353 mRNA. Translation: BAA34530.1 . Different initiation.
AK022469 mRNA. Translation: BAB14046.1 .
AK022816 mRNA. Translation: BAG51119.1 .
AK302896 mRNA. Translation: BAG64069.1 .
AK309120 mRNA. No translation available.
BX538211 mRNA. Translation: CAD98070.1 .
AC073957 Genomic DNA. No translation available.
AC099731 Genomic DNA. No translation available.
BC013613 mRNA. Translation: AAH13613.1 .
BC142707 mRNA. Translation: AAI42708.1 .
AF202724 mRNA. Translation: AAF15888.1 .
CCDSi CCDS43533.1. [O94901-5 ]
CCDS47525.1. [O94901-8 ]
CCDS55078.1. [O94901-7 ]
CCDS55079.1. [O94901-2 ]
CCDS55080.1. [O94901-6 ]
RefSeqi NP_001124437.1. NM_001130965.2. [O94901-8 ]
NP_001165415.1. NM_001171944.1. [O94901-6 ]
NP_001165416.1. NM_001171945.1. [O94901-7 ]
NP_001165417.1. NM_001171946.1. [O94901-2 ]
NP_079430.3. NM_025154.5. [O94901-5 ]
UniGenei Hs.438072.

3D structure databases

ProteinModelPortali O94901.
SMRi O94901. Positions 616-810.
ModBasei Search...

Protein-protein interaction databases

BioGridi 116935. 7 interactions.
IntActi O94901. 4 interactions.

PTM databases

PhosphoSitei O94901.

Proteomic databases

MaxQBi O94901.
PaxDbi O94901.
PRIDEi O94901.

Protocols and materials databases

DNASUi 23353.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000389574 ; ENSP00000374225 ; ENSG00000164828 . [O94901-5 ]
ENST00000401592 ; ENSP00000384015 ; ENSG00000164828 . [O94901-8 ]
ENST00000403868 ; ENSP00000383947 ; ENSG00000164828 . [O94901-2 ]
ENST00000425407 ; ENSP00000392309 ; ENSG00000164828 . [O94901-5 ]
ENST00000452783 ; ENSP00000413439 ; ENSG00000164828 . [O94901-6 ]
ENST00000457378 ; ENSP00000395952 ; ENSG00000164828 . [O94901-7 ]
GeneIDi 23353.
KEGGi hsa:23353.
UCSCi uc003sje.1. human. [O94901-3 ]
uc003sjf.3. human. [O94901-5 ]
uc003sjk.3. human. [O94901-1 ]
uc021zyl.1. human. [O94901-2 ]

Organism-specific databases

CTDi 23353.
GeneCardsi GC07P000857.
H-InvDB HIX0078880.
HGNCi HGNC:18587. SUN1.
HPAi HPA008346.
HPA008461.
MIMi 607723. gene.
neXtProti NX_O94901.
PharmGKBi PA165618311.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG285464.
HOGENOMi HOG000253025.
HOVERGENi HBG104132.
OrthoDBi EOG7J446H.
PhylomeDBi O94901.
TreeFami TF323915.

Enzyme and pathway databases

Reactomei REACT_75792. Meiotic synapsis.

Miscellaneous databases

GeneWikii UNC84A.
GenomeRNAii 23353.
NextBioi 27033591.
PROi O94901.
SOURCEi Search...

Gene expression databases

ArrayExpressi O94901.
Bgeei O94901.
CleanExi HS_UNC84A.
Genevestigatori O94901.

Family and domain databases

InterProi IPR012919. Sad1_UNC_C.
IPR018539. SUN1.
[Graphical view ]
Pfami PF09387. MRP. 2 hits.
PF07738. Sad1_UNC. 1 hit.
[Graphical view ]
PROSITEi PS51469. SUN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-118.
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 5; 6 AND 7), VARIANT TYR-118.
    Tissue: Mammary gland, Substantia nigra and Testis.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Cerebellum.
  4. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 8), VARIANT TYR-118.
    Tissue: Ovary.
  6. "UNC-84 localizes to the nuclear envelope and is required for nuclear migration and anchoring during C. elegans development."
    Malone C.J., Fixsen W.D., Horvitz H.R., Han M.
    Development 126:3171-3181(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 389-812.
  7. "Nuclear membrane proteins with potential disease links found by subtractive proteomics."
    Schirmer E.C., Florens L., Guan T., Yates J.R. III, Gerace L.
    Science 301:1380-1382(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
  8. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-138, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Telomere anchoring at the nuclear periphery requires the budding yeast Sad1-UNC-84 domain protein Mps3."
    Bupp J.M., Martin A.E., Stensrud E.S., Jaspersen S.L.
    J. Cell Biol. 179:845-854(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH MPS3.
  10. "Characterization of the structures involved in localization of the SUN proteins to the nuclear envelope and the centrosome."
    Wang Q., Du X., Cai Z., Greene M.I.
    DNA Cell Biol. 25:554-562(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, SUBUNIT, ASSOCIATION WITH THE CENTROSOME.
  11. "Nuclear envelope localization of human UNC84A does not require nuclear lamins."
    Hasan S., Guttinger S., Muhlhausser P., Anderegg F., Burgler S., Kutay U.
    FEBS Lett. 580:1263-1268(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  12. "Histone acetyltransferase hALP and nuclear membrane protein hsSUN1 function in de-condensation of mitotic chromosomes."
    Chi Y.-H., Haller K., Peloponese J.-M. Jr., Jeang K.-T.
    J. Biol. Chem. 282:27447-27458(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NAT10.
  13. Cited for: SUBCELLULAR LOCATION, TOPOLOGY, SUBUNIT, INTERACTION WITH SUN2.
  14. "Structural requirements for the assembly of LINC complexes and their function in cellular mechanical stiffness."
    Stewart-Hutchinson P.J., Hale C.M., Wirtz D., Hodzic D.
    Exp. Cell Res. 314:1892-1905(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SYNE1; SYNE2 AND SYNE3, FUNCTION OF THE LINC COMPLEXES.
  15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  16. "Mammalian SUN protein interaction networks at the inner nuclear membrane and their role in laminopathy disease processes."
    Haque F., Mazzeo D., Patel J.T., Smallwood D.T., Ellis J.A., Shanahan C.M., Shackleton S.
    J. Biol. Chem. 285:3487-3498(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, INTERACTION WITH EMD; LMNA AND SYNE2, DOMAIN, ASSOCIATION WITH THE NUCLEOSKELETON.
  17. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-100 AND SER-138, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-333 (ISOFORM 9), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  18. "Contribution of SUN1 mutations to the pathomechanism in muscular dystrophies."
    Li P., Meinke P., Huong Le T.T., Wehnert M., Noegel A.A.
    Hum. Mutat. 35:452-461(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS VAL-203 AND VAL-614.

Entry informationi

Entry nameiSUN1_HUMAN
AccessioniPrimary (citable) accession number: O94901
Secondary accession number(s): A5PL20
, B3KMV7, B4DZF7, B7WNY4, B7WP53, E9PDU4, E9PF23, F8WD13, Q96CZ7, Q9HA14, Q9UH98
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 2, 2002
Last sequence update: July 11, 2003
Last modified: September 3, 2014
This is version 133 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi