Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PHD finger protein 14

Gene

PHF14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri319 – 380PHD-type 1PROSITE-ProRule annotationAdd BLAST62
Zinc fingeri382 – 415C2HC pre-PHD-typePROSITE-ProRule annotationAdd BLAST34
Zinc fingeri439 – 499PHD-type 2PROSITE-ProRule annotationAdd BLAST61
Zinc fingeri725 – 779PHD-type 3PROSITE-ProRule annotationAdd BLAST55

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000106443-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
PHD finger protein 14
Gene namesi
Name:PHF14
Synonyms:KIAA0783
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:22203. PHF14.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000106443.
PharmGKBiPA134867397.

Polymorphism and mutation databases

BioMutaiPHF14.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000593061 – 888PHD finger protein 14Add BLAST888

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei26PhosphoserineCombined sources1
Modified residuei29PhosphoserineCombined sources1
Modified residuei84PhosphoserineCombined sources1
Modified residuei91PhosphoserineCombined sources1
Modified residuei196PhosphoserineCombined sources1
Modified residuei206PhosphotyrosineCombined sources1
Modified residuei208PhosphoserineCombined sources1
Modified residuei287PhosphothreonineCombined sources1
Modified residuei290PhosphoserineCombined sources1
Modified residuei294PhosphoserineCombined sources1
Modified residuei298PhosphoserineCombined sources1
Modified residuei302PhosphoserineCombined sources1
Modified residuei308PhosphoserineCombined sources1
Modified residuei359PhosphoserineCombined sources1
Modified residuei530PhosphoserineCombined sources1
Modified residuei781PhosphoserineBy similarity1
Modified residuei782PhosphoserineBy similarity1
Modified residuei835PhosphoserineCombined sources1
Isoform 2 (identifier: O94880-2)
Modified residuei651PhosphoserineCombined sourcesCurated1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO94880.
MaxQBiO94880.
PaxDbiO94880.
PeptideAtlasiO94880.
PRIDEiO94880.

PTM databases

iPTMnetiO94880.
PhosphoSitePlusiO94880.

Expressioni

Gene expression databases

BgeeiENSG00000106443.
CleanExiHS_PHF14.
ExpressionAtlasiO94880. baseline and differential.
GenevisibleiO94880. HS.

Organism-specific databases

HPAiHPA000538.

Interactioni

Protein-protein interaction databases

BioGridi115032. 21 interactors.
IntActiO94880. 21 interactors.
STRINGi9606.ENSP00000385795.

Structurei

3D structure databases

ProteinModelPortaliO94880.
SMRiO94880.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi62 – 137Glu/Lys-richAdd BLAST76

Sequence similaritiesi

Contains 1 C2HC pre-PHD-type zinc finger.PROSITE-ProRule annotation
Contains 3 PHD-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri319 – 380PHD-type 1PROSITE-ProRule annotationAdd BLAST62
Zinc fingeri382 – 415C2HC pre-PHD-typePROSITE-ProRule annotationAdd BLAST34
Zinc fingeri439 – 499PHD-type 2PROSITE-ProRule annotationAdd BLAST61
Zinc fingeri725 – 779PHD-type 3PROSITE-ProRule annotationAdd BLAST55

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0957. Eukaryota.
COG5141. LUCA.
GeneTreeiENSGT00860000133875.
HOGENOMiHOG000015231.
HOVERGENiHBG053584.
InParanoidiO94880.
OMAiFCDACKN.
OrthoDBiEOG091G02FR.
PhylomeDBiO94880.
TreeFamiTF316118.

Family and domain databases

Gene3Di3.30.40.10. 2 hits.
InterProiIPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00628. PHD. 2 hits.
[Graphical view]
SMARTiSM00249. PHD. 3 hits.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 2 hits.
PROSITEiPS51805. EPHD. 1 hit.
PS01359. ZF_PHD_1. 2 hits.
PS50016. ZF_PHD_2. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

Isoform 1 (identifier: O94880-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRSSKRRQV KPLAASLLEA LDYDSSDDSD FKVGDASDSE GSGNGSEDAS
60 70 80 90 100
KDSGEGSCSD SEENILEEEL NEDIKVKEEQ LKNSAEEEVL SSEKQLIKME
110 120 130 140 150
KKEEEENGER PRKKKEKEKE KEKEKEKEKE REKEKEKATV SENVAASAAA
160 170 180 190 200
TTPATSPPAV NTSPSVPTTT TATEEQVSEP KKWNLRRNRP LLDFVSMEEL
210 220 230 240 250
NDMDDYDSED DNDWRPTVVK RKGRSASQKE GSDGDNEDDE DEGSGSDEDE
260 270 280 290 300
NDEGNDEDHS SPASEGGCKK KKSKVLSRNS ADDEELTNDS LTLSQSKSNE
310 320 330 340 350
DSLILEKSQN WSSQKMDHIL ICCVCLGDNS EDADEIIQCD NCGITVHEGC
360 370 380 390 400
YGVDGESDSI MSSASENSTE PWFCDACKCG VSPSCELCPN QDGIFKETDA
410 420 430 440 450
GRWVHIVCAL YVPGVAFGDI DKLRPVTLTE MNYSKYGAKE CSFCEDPRFA
460 470 480 490 500
RTGVCISCDA GMCRAYFHVT CAQKEGLLSE AAAEEDIADP FFAYCKQHAD
510 520 530 540 550
RLDRKWKRKN YLALQSYCKM SLQEREKQLS PEAQARINAR LQQYRAKAEL
560 570 580 590 600
ARSTRPQAWV PREKLPRPLT SSASAIRKLM RKAELMGIST DIFPVDNSDT
610 620 630 640 650
SSSVDGRRKH KQPALTADFV NYYFERNMRM IQIQENMAEQ KNIKDKLENE
660 670 680 690 700
QEKLHVEYNK LCESLEELQN LNGKLRSEGQ GIWALLGRIT GQKLNIPAIL
710 720 730 740 750
RAPKERKPSK KEGGTQKTST LPAVLYSCGI CKKNHDQHLL LLCDTCKLHY
760 770 780 790 800
HLGCLDPPLT RMPRKTKNSY WQCSECDQAG SSDMEADMAM ETLPDGTKRS
810 820 830 840 850
RRQIKEPVKF VPQDVPPEPK KIPIRNTRTR GRKRSFVPEE EKHEERVPRE
860 870 880
RRQRQSVLQK KPKAEDLRTE CATCKGTGDN ENLVRYPS
Length:888
Mass (Da):100,053
Last modified:November 24, 2009 - v2
Checksum:iDC356A84BE525932
GO
Isoform 2 (identifier: O94880-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-285: Missing.
     286-300: LTNDSLTLSQSKSNE → MIVQMTVILKLEMPQ
     886-888: YPS → CDECRLCYHFGCLDPPLKKSPKQTGYGWICQECDSSSSKEDENEAERKNISQELNMEQKNPKK

Note: Dubious isoform. Alternative initiation from a downstream AUG is supported by ribosome profiling data.Combined sourcesCurated
Show »
Length:663
Mass (Da):75,504
Checksum:i5B081B62F5792D16
GO

Sequence cautioni

The sequence BAA34503 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti395F → S in BAG58394 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_018480115K → R.1 PublicationCorresponds to variant rs218966dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0359991 – 285Missing in isoform 2. 1 PublicationAdd BLAST285
Alternative sequenceiVSP_036000286 – 300LTNDS…SKSNE → MIVQMTVILKLEMPQ in isoform 2. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_036001886 – 888YPS → CDECRLCYHFGCLDPPLKKS PKQTGYGWICQECDSSSSKE DENEAERKNISQELNMEQKN PKK in isoform 2. 1 Publication3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018326 mRNA. Translation: BAA34503.2. Different initiation.
AK295461 mRNA. Translation: BAG58394.1.
AC005007 Genomic DNA. No translation available.
AC007029 Genomic DNA. No translation available.
AC080064 Genomic DNA. No translation available.
AC104089 Genomic DNA. No translation available.
CH471073 Genomic DNA. Translation: EAW93634.1.
BC152414 mRNA. Translation: AAI52415.1.
CCDSiCCDS47542.1. [O94880-1]
RefSeqiNP_055475.2. NM_014660.3. [O94880-1]
UniGeneiHs.655688.

Genome annotation databases

EnsembliENST00000403050; ENSP00000385795; ENSG00000106443. [O94880-1]
GeneIDi9678.
KEGGihsa:9678.
UCSCiuc003sry.3. human. [O94880-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018326 mRNA. Translation: BAA34503.2. Different initiation.
AK295461 mRNA. Translation: BAG58394.1.
AC005007 Genomic DNA. No translation available.
AC007029 Genomic DNA. No translation available.
AC080064 Genomic DNA. No translation available.
AC104089 Genomic DNA. No translation available.
CH471073 Genomic DNA. Translation: EAW93634.1.
BC152414 mRNA. Translation: AAI52415.1.
CCDSiCCDS47542.1. [O94880-1]
RefSeqiNP_055475.2. NM_014660.3. [O94880-1]
UniGeneiHs.655688.

3D structure databases

ProteinModelPortaliO94880.
SMRiO94880.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115032. 21 interactors.
IntActiO94880. 21 interactors.
STRINGi9606.ENSP00000385795.

PTM databases

iPTMnetiO94880.
PhosphoSitePlusiO94880.

Polymorphism and mutation databases

BioMutaiPHF14.

Proteomic databases

EPDiO94880.
MaxQBiO94880.
PaxDbiO94880.
PeptideAtlasiO94880.
PRIDEiO94880.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000403050; ENSP00000385795; ENSG00000106443. [O94880-1]
GeneIDi9678.
KEGGihsa:9678.
UCSCiuc003sry.3. human. [O94880-1]

Organism-specific databases

CTDi9678.
GeneCardsiPHF14.
H-InvDBHIX0006485.
HGNCiHGNC:22203. PHF14.
HPAiHPA000538.
neXtProtiNX_O94880.
OpenTargetsiENSG00000106443.
PharmGKBiPA134867397.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0957. Eukaryota.
COG5141. LUCA.
GeneTreeiENSGT00860000133875.
HOGENOMiHOG000015231.
HOVERGENiHBG053584.
InParanoidiO94880.
OMAiFCDACKN.
OrthoDBiEOG091G02FR.
PhylomeDBiO94880.
TreeFamiTF316118.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000106443-MONOMER.

Miscellaneous databases

ChiTaRSiPHF14. human.
GenomeRNAii9678.
PROiO94880.

Gene expression databases

BgeeiENSG00000106443.
CleanExiHS_PHF14.
ExpressionAtlasiO94880. baseline and differential.
GenevisibleiO94880. HS.

Family and domain databases

Gene3Di3.30.40.10. 2 hits.
InterProiIPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00628. PHD. 2 hits.
[Graphical view]
SMARTiSM00249. PHD. 3 hits.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 2 hits.
PROSITEiPS51805. EPHD. 1 hit.
PS01359. ZF_PHD_1. 2 hits.
PS50016. ZF_PHD_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPHF14_HUMAN
AccessioniPrimary (citable) accession number: O94880
Secondary accession number(s): A7MCZ3, B4DI82
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: November 24, 2009
Last modified: November 30, 2016
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.