O94880 (PHF14_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 85.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: PHD finger protein 14 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 888 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Post-translational modification | Phosphorylated upon DNA damage, probably by ATM or ATR By similarity. Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 |
| Sequence similarities | Contains 2 PHD-type zinc fingers. |
| Sequence caution | The sequence BAA34503.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Zinc-finger |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Molecular function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94880-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94880-2) The sequence of this isoform differs from the canonical sequence as follows: 1-285: Missing. 286-300: LTNDSLTLSQSKSNE → MIVQMTVILKLEMPQ 886-888: YPS → CDECRLCYHFGCLDPPLKKSPKQTGYGWICQECDSSSSKEDENEAERKNISQELNMEQKNPKK | ||||||
| Note: Phosphorylated on Ser-651. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 888 | 888 | PHD finger protein 14 | PRO_0000059306 | |||||
Regions | |||||||||
| Zinc finger | 319 – 380 | 62 | PHD-type 1 | ||||||
| Zinc finger | 725 – 779 | 55 | PHD-type 2 | ||||||
| Compositional bias | 62 – 137 | 76 | Glu/Lys-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 91 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 208 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 280 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 287 | 1 | Phosphothreonine Ref.7 Ref.9 Ref.10 Ref.11 | ||||||
| Modified residue | 290 | 1 | Phosphoserine Ref.6 Ref.7 Ref.9 Ref.10 Ref.11 | ||||||
| Modified residue | 294 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 298 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 302 | 1 | Phosphoserine Ref.7 Ref.11 | ||||||
| Modified residue | 530 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 553 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 835 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 285 | 285 | Missing in isoform 2. | VSP_035999 | |||||
| Alternative sequence | 286 – 300 | 15 | LTNDS…SKSNE → MIVQMTVILKLEMPQ in isoform 2. | VSP_036000 | |||||
| Alternative sequence | 886 – 888 | 3 | YPS → CDECRLCYHFGCLDPPLKKS PKQTGYGWICQECDSSSSKE DENEAERKNISQELNMEQKN PKK in isoform 2. | VSP_036001 | |||||
| Natural variant | 115 | 1 | K → R. Ref.1 Corresponds to variant rs218966 [ dbSNP | Ensembl ]. | VAR_018480 | |||||
Experimental info | |||||||||
| Sequence conflict | 395 | 1 | F → S in BAG58394. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:277-286(1998) [PubMed: 9872452] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-115. Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Hippocampus. |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-290, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-287; SER-290; SER-298; SER-302; SER-553 AND SER-835, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis." Wang B., Malik R., Nigg E.A., Korner R. Anal. Chem. 80:9526-9533(2008) [PubMed: 19007248] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-91 AND SER-530, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-208; SER-280; THR-287; SER-290 AND SER-294, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-651 (ISOFORM 2), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-287 AND SER-290, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-287; SER-290 AND SER-302, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB018326 mRNA. Translation: BAA34503.2. Different initiation. AK295461 mRNA. Translation: BAG58394.1. AC005007 Genomic DNA. No translation available. AC007029 Genomic DNA. No translation available. AC080064 Genomic DNA. No translation available. AC104089 Genomic DNA. No translation available. CH471073 Genomic DNA. Translation: EAW93634.1. BC152414 mRNA. Translation: AAI52415.1. |
| IPI | IPI00472782. IPI00941211. |
| RefSeq | NP_055475.2. NM_014660.3. |
| UniGene | Hs.655688. |
3D structure databases | |
| ProteinModelPortal | O94880. |
| SMR | O94880. Positions 317-408, 688-780. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O94880. 2 interactions. |
| STRING | O94880. |
Proteomic databases | |
| PRIDE | O94880. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000403050; ENSP00000385795; ENSG00000106443. |
| GeneID | 9678. |
| KEGG | hsa:9678. |
Organism-specific databases | |
| CTD | 9678. |
| GeneCards | GC07P010980. |
| H-InvDB | HIX0006485. |
| HGNC | HGNC:22203. PHF14. |
| HPA | HPA000538. |
| neXtProt | NX_O94880. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG15559. |
| GeneTree | ENSGT00600000084089. |
| HOVERGEN | HBG053584. |
| OrthoDB | EOG437RD8. |
| PhylomeDB | O94880. |
Gene expression databases | |
| ArrayExpress | O94880. |
| Bgee | O94880. |
| CleanEx | HS_PHF14. |
| Genevestigator | O94880. |
| GermOnline | ENSG00000106443. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR019786. Zinc_finger_PHD-type_CS. IPR011011. Znf_FYVE_PHD. IPR001965. Znf_PHD. IPR019787. Znf_PHD-finger. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] |
| Gene3D | G3DSA:3.30.40.10. Znf_RING/FYVE/PHD. 2 hits. |
| Pfam | PF00628. PHD. 2 hits. [Graphical view] |
| SMART | SM00249. PHD. 3 hits. [Graphical view] |
| SUPFAM | SSF57903. FYVE_PHD_ZnF. 2 hits. |
| PROSITE | PS01359. ZF_PHD_1. 2 hits. PS50016. ZF_PHD_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 36345. |
Entry information
| Entry name | PHF14_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94880 Secondary accession number(s): A7MCZ3, B4DI82 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with