Reviewed,
UniProtKB/Swiss-Prot O94880 (PHF14_HUMAN)
Last modified
June 16, 2009.
Version 61.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: PHD finger protein 14 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 888 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Post-translational modification | Phosphorylated upon DNA damage, probably by ATM or ATR By similarity. |
| Sequence similarities | Contains 2 PHD-type zinc fingers. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Zinc-finger |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Molecular function | protein binding Inferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94880-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94880-2) The sequence of this isoform differs from the canonical sequence as follows: 1-285: Missing. 286-300: LTNDSLTLSQSKSNE → MIVQMTVILKLEMPQ 886-888: YPS → CDECRLCYHFGCLDPPLKKSPKQTGYGWICQECDSSSSKEDENEAERKNISQELNMEQKNPKK | ||||||
| Note: Phosphorylated on Ser-651. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 888 | 888 | PHD finger protein 14 | PRO_0000059306 | |||||
Regions | |||||||||
| Zinc finger | 319 – 380 | 62 | PHD-type 1 | ||||||
| Zinc finger | 725 – 779 | 55 | PHD-type 2 | ||||||
| Compositional bias | 62 – 137 | 76 | Glu/Lys-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 208 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 280 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 287 | 1 | Phosphothreonine Ref.6 Ref.5 | ||||||
| Modified residue | 290 | 1 | Phosphoserine Ref.6 Ref.5 Ref.4 | ||||||
| Modified residue | 294 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 298 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 302 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 553 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 835 | 1 | Phosphoserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 285 | 285 | Missing in isoform 2. | VSP_035999 | |||||
| Alternative sequence | 286 – 300 | 15 | LTNDS…SKSNE → MIVQMTVILKLEMPQ in isoform 2. | VSP_036000 | |||||
| Alternative sequence | 886 – 888 | 3 | YPS → CDECRLCYHFGCLDPPLKKS PKQTGYGWICQECDSSSSKE DENEAERKNISQELNMEQKN PKK in isoform 2. | VSP_036001 | |||||
| Natural variant | 115 | 1 | R → K: dbSNP rs218966. Ref.3 | VAR_018480 | |||||
Experimental info | |||||||||
| Sequence conflict | 395 | 1 | F → S in BAG58394. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:277-286(1998) [PubMed: 9872452] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Hippocampus. |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT LYS-115. |
| [4] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-290, MASS SPECTROMETRY. Tissue: Epithelium. |
| [5] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-287; SER-290; SER-298; SER-302; SER-553 AND SER-835, MASS SPECTROMETRY. Tissue: Epithelium. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-208; SER-280; THR-287; SER-290 AND SER-294, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-651 (ISOFORM 2), MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| AB018326 mRNA. Translation: BAA34503.2. Different initiation. AK295461 mRNA. Translation: BAG58394.1. AC005007 Genomic DNA. No translation available. AC007029 Genomic DNA. No translation available. AC080064 Genomic DNA. No translation available. AC104089 Genomic DNA. No translation available. | |
| IPI | IPI00454969. IPI00472782. |
| RefSeq | NP_001007158.1. NP_055475.2. |
| UniGene | Hs.655688 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1MM2 based on UniProtKB Q14839. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | O94880. |
Genome annotation databases | |
| Ensembl | ENSG00000106443. Homo sapiens. [Contig view] |
| GeneID | 9678. |
| KEGG | hsa:9678. |
Organism-specific databases | |
| GeneCards | GC07P010980. |
| H-InvDB | HIX0006485. |
| HGNC | HGNC:22203. PHF14. |
| HPA | HPA000538. |
| PharmGKB | PA134867397. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | O94880. |
| HOVERGEN | O94880. |
Gene expression databases | |
| ArrayExpress | O94880. |
| Bgee | O94880. |
| CleanEx | HS_PHF14. |
| GermOnline | ENSG00000106443. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR019786. Zinc_finger_PHD-type_CS. IPR001965. Znf_PHD. IPR019787. Znf_PHD-finger. [Graphical view] |
| Pfam | PF00628. PHD. 2 hits. [Graphical view] |
| SMART | SM00249. PHD. 3 hits. [Graphical view] |
| PROSITE | PS01359. ZF_PHD_1. 2 hits. PS50016. ZF_PHD_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 36345. |
Entry information
| Entry name | PHF14_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94880 Secondary accession number(s): B4DI82 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with


