O94875 (SRBS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sorbin and SH3 domain-containing protein 2 Alternative name(s): Arg/Abl-interacting protein 2 Short name=ArgBP2 Sorbin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1100 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1 or with AKT1 and PAK1, thus mediating AKT1-mediated activation of PAK1. Isoform 6 increases water and sodium absorption in the intestine and gall-bladder. Ref.1 Ref.9 |
| Subunit structure | Interacts with ABL, CBL, DNM1, DNM2, FLOT1, MLLT4/afadin, PTK2B/PYK2, SAPAP, SPTAN1, SYNJ1, SYNJ2, VCL/vinculin, and WASF By similarity. Interacts with ABL1/c-Abl, ABL2/v-Abl/Arg, ACTN, AKT1, CBL, PALLD and PAK1. Ref.1 Ref.9 Ref.10 Ref.11 |
| Subcellular location | Cytoplasm › perinuclear region. Note: Found at the Z-disk sarcomeres, stress fibers, dense bodies and focal adhesion. Ref.1 Ref.10 |
| Tissue specificity | Abundantly expressed in heart. In cardiac muscle cells, located in the Z-disks of sarcomere. Also found, but to a lower extent, in small and large intestine, pancreas, thymus, colon, spleen, prostate, testis, brain, ovary and epithelial cells. Ref.1 Ref.2 |
| Post-translational modification | |
| Sequence similarities | Contains 3 SH3 domains. Contains 1 SoHo domain. |
| Sequence caution | The sequence BAA34497.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat SH3 domain |
| PTM | Amidation Phosphoprotein Ubl conjugation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | Z disc Non-traceable author statement Ref.1. Source: UniProtKB actin cytoskeletonTraceable author statement Ref.1. Source: ProtInc nucleusNon-traceable author statement Ref.1. Source: UniProtKB perinuclear region of cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | cytoskeletal adaptor activity Traceable author statement Ref.1. Source: ProtInc structural constituent of cytoskeletonTraceable author statement Ref.1. Source: ProtInc structural constituent of muscleTraceable author statement Ref.1. Source: ProtInc zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94875-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94875-2) Also known as: ArgBP2a; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM 228-228: P → PTDRINPDDIDLENEPWYKFFSELEFGRPPPKKPLDYVQDHSSGVFNE 308-834: Missing. | ||||||
| Isoform 3 (identifier: O94875-3) The sequence of this isoform differs from the canonical sequence as follows: 228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE 308-834: Missing. | ||||||
| Note: Contains a phosphoserine at position 258. Contains a phosphoserine at position 260. | ||||||
| Isoform 4 (identifier: O94875-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM 228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE 308-834: Missing. | ||||||
| Note: Contains a phosphoserine at position 304. Contains a phosphoserine at position 306. | ||||||
| Isoform 5 (identifier: O94875-5) Also known as: ArgBP2b; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM 228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE 308-834: Missing. 1050-1100: YNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL → GYTLT | ||||||
| Note: Contains a phosphoserine at position 304. Contains a phosphoserine at position 306. | ||||||
| Isoform 6 (identifier: O94875-6) Also known as: Sorbin; The sequence of this isoform differs from the canonical sequence as follows: 1-81: Missing. 82-89: GIPTAIRT → MKATTPLQ 229-237: ASLYQSSID → VSKPQAGRR 238-1100: Missing. | ||||||
| Note: Contains a alanine amide at position 153. | ||||||
| Isoform 7 (identifier: O94875-7) The sequence of this isoform differs from the canonical sequence as follows: 1-89: MSYYQRPFSP...ESGIPTAIRT → MKATTPLQ 112-126: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 8 (identifier: O94875-8) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNTGRDSQSPDSAWRSYNDGNQETLNGDATYSSLAAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM 228-228: P → PPPKKPLDYVQDHSSGVFNE 308-834: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 9 (identifier: O94875-9) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSVTLTSVKR...GNSGGAVSPM 112-126: Missing. 308-834: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 10 (identifier: O94875-10) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MYSNEDSRQT...GNSGGAVSPM 228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE 308-834: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1100 | 1100 | Sorbin and SH3 domain-containing protein 2 | PRO_0000344477 | |||||
Regions | |||||||||
| Domain | 66 – 127 | 62 | SoHo | ||||||
| Domain | 863 – 922 | 60 | SH3 1 | ||||||
| Domain | 938 – 999 | 62 | SH3 2 | ||||||
| Domain | 1041 – 1100 | 60 | SH3 3 | ||||||
| Compositional bias | 167 – 182 | 16 | Pro-rich | ||||||
| Compositional bias | 640 – 652 | 13 | His-rich | ||||||
| Compositional bias | 931 – 934 | 4 | Poly-Pro | ||||||
Amino acid modifications | |||||||||
| Modified residue | 30 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 154 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 157 | 1 | Phosphoserine Ref.12 Ref.13 | ||||||
| Modified residue | 259 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 277 | 1 | Phosphothreonine Ref.12 | ||||||
| Modified residue | 278 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 298 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 299 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 301 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 302 | 1 | Phosphoserine Ref.12 Ref.13 | ||||||
| Modified residue | 371 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 376 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 750 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1017 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1018 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 89 | 89 | MSYYQ…TAIRT → MKATTPLQ in isoform 7. | VSP_043665 | |||||
| Alternative sequence | 1 – 81 | 81 | Missing in isoform 6. | VSP_034791 | |||||
| Alternative sequence | 1 | 1 | M → MYSNEDSRQTIVYSEESNTT MSYTQKITNPLPAASSTDPA PFANINTPVLQEDYRQDSQT RRISTLKLTHNQDLGSSSPI STPQFSKSVEVPSFLKRPRS LTPNPVPETHTASLSIQIAP LSGQDLESHKQLPELSPETA KIPLQQERQKSAVAAASQSS DCRVSQITVNGNSGGAVSPM in isoform 10. | VSP_046220 | |||||
| Alternative sequence | 1 | 1 | M → MNTGRDSQSPDSAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 2, isoform 4 and isoform 5. | VSP_034792 | |||||
| Alternative sequence | 1 | 1 | M → MNTGRDSQSPDSAWRSYNDG NQETLNGDATYSSLAAKGFR SVRPNLQDKRSPTQSQITVN GNSGGAVSPM in isoform 8. | VSP_045640 | |||||
| Alternative sequence | 1 | 1 | M → MSVTLTSVKRVQSSPNLLAA GRDSQSPDSAWRSYNDGNQE TLNGDATYSSLAAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 9. | VSP_046219 | |||||
| Alternative sequence | 82 – 89 | 8 | GIPTAIRT → MKATTPLQ in isoform 6. | VSP_034793 | |||||
| Alternative sequence | 112 – 126 | 15 | Missing in isoform 7 and isoform 9. | VSP_043666 | |||||
| Alternative sequence | 228 | 1 | P → PTDRINPDDIDLENEPWYKF FSELEFGRPPPKKPLDYVQD HSSGVFNE in isoform 2. | VSP_034794 | |||||
| Alternative sequence | 228 | 1 | P → PPPLPTTPTPVPREPGRKPL SSSRLGEVTGSPSPPPRSGA PTPSSRAPALSPTRPPKKPL DYVQDHSSGVFNE in isoform 3, isoform 4, isoform 5 and isoform 10. | VSP_034795 | |||||
| Alternative sequence | 228 | 1 | P → PPPKKPLDYVQDHSSGVFNE in isoform 8. | VSP_045641 | |||||
| Alternative sequence | 229 – 237 | 9 | ASLYQSSID → VSKPQAGRR in isoform 6. | VSP_034796 | |||||
| Alternative sequence | 238 – 1100 | 863 | Missing in isoform 6. | VSP_034797 | |||||
| Alternative sequence | 308 – 834 | 527 | Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 8, isoform 9 and isoform 10. | VSP_034798 | |||||
| Alternative sequence | 1050 – 1100 | 51 | YNYTP…YVKRL → GYTLT in isoform 5. | VSP_034799 | |||||
| Natural variant | 1048 | 1 | A → V. Corresponds to variant rs725185 [ dbSNP | Ensembl ]. | VAR_045624 | |||||
Experimental info | |||||||||
| Sequence conflict | 73 | 1 | P → L in AK225327. Ref.5 | ||||||
| Sequence conflict | 206 | 1 | R → Q in AK225327. Ref.5 | ||||||
| Sequence conflict | 1034 | 1 | F → L in BAH11501. Ref.4 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 13 | 1 | A → P in AAC05509. Ref.1 | ||||||
| Isoform 5: | |||||||||
| Sequence conflict | 13 | 1 | A → P in AAC05508. Ref.1 | ||||||
| Isoform 10: | |||||||||
| Sequence conflict | 424 | 1 | K → E in AK225812. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "ArgBP2, a multiple Src homology 3 domain-containing, Arg/Abl-interacting protein, is phosphorylated in v-Abl-transformed cells and localized in stress fibers and cardiocyte Z-disks." Wang B., Golemis E.A., Kruh G.D. J. Biol. Chem. 272:17542-17550(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 5), NUCLEOTIDE SEQUENCE [MRNA] OF 1-1049 (ISOFORM 4), PHOSPHORYLATION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH ABL1 AND ABL2, FUNCTION. Tissue: Brain. |
| [2] | "Coding region of the sorbin gene in different species." Wahbi K., Magaud J.-P., Pansu D., Descroix-Vagne M. Peptides 22:2045-2053(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), AMIDATION AT ALA-153 (ISOFORM 6), TISSUE SPECIFICITY. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 7 AND 8). Tissue: Thalamus and Urinary bladder. |
| [5] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 9 AND 10). Tissue: Heart and Hepatoma. |
| [6] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Lymph. |
| [9] | "Cbl-ArgBP2 complex mediates ubiquitination and degradation of c-Abl." Soubeyran P., Barac A., Szymkiewicz I., Dikic I. Biochem. J. 370:29-34(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CBL, UBIQUITINATION BY CBL, FUNCTION. |
| [10] | "Involvement of palladin and alpha-actinin in targeting of the Abl/Arg kinase adaptor ArgBP2 to the actin cytoskeleton." Roenty M., Taivainen A., Moza M., Kruh G.D., Ehler E., Carpen O. Exp. Cell Res. 310:88-98(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PALLD AND ACTN, SUBCELLULAR LOCATION. |
| [11] | "ArgBP2gamma interacts with Akt and p21-activated kinase-1 and promotes cell survival." Yuan Z.-Q., Kim D., Kaneko S., Sussman M., Bokoch G.M., Kruh G.D., Nicosia S.V., Testa J.R., Cheng J.Q. J. Biol. Chem. 280:21483-21490(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH AKT1 AND PAK1, UBIQUITINATION BY CBL, PHOSPHORYLATION. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157; THR-277; SER-301 AND SER-302, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 AND SER-260 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304 AND SER-306 (ISOFORMS 4 AND 5), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157; SER-298; SER-299 AND SER-302, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 AND SER-260 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304 AND SER-306 (ISOFORMS 4 AND 5), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF049884 mRNA. Translation: AAC05508.1. AF049885 mRNA. Translation: AAC05509.1. AB018320 mRNA. Translation: BAA34497.2. Different initiation. AK293400 mRNA. Translation: BAH11501.1. AK296461 mRNA. Translation: BAH12362.1. AK225327 mRNA. No translation available. AK225812 mRNA. No translation available. AC093797 Genomic DNA. No translation available. AC096659 Genomic DNA. No translation available. AC104805 Genomic DNA. No translation available. AC108472 Genomic DNA. No translation available. CH471056 Genomic DNA. Translation: EAX04630.1. CH471056 Genomic DNA. Translation: EAX04631.1. CH471056 Genomic DNA. Translation: EAX04632.1. CH471056 Genomic DNA. Translation: EAX04635.1. CH471056 Genomic DNA. Translation: EAX04636.1. BC011883 mRNA. Translation: AAH11883.1. | ||||||||||||
| IPI | IPI00061793. IPI00477577. IPI00747799. IPI00787549. IPI00900281. IPI00900295. IPI00921885. IPI00923523. IPI00923573. IPI01013920. | ||||||||||||
| RefSeq | NP_001139142.1. NM_001145670.1. NP_001139143.1. NM_001145671.2. NP_001139144.1. NM_001145672.1. NP_001139145.1. NM_001145673.1. NP_001139146.1. NM_001145674.1. NP_001257700.1. NM_001270771.1. NP_003594.3. NM_003603.6. NP_066547.1. NM_021069.4. | ||||||||||||
| UniGene | Hs.619806. Hs.655143. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O94875. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-31634N. | ||||||||||||
| IntAct | O94875. 9 interactions. | ||||||||||||
| MINT | MINT-196404. | ||||||||||||
| STRING | 9606.ENSP00000284776. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O94875. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O94875. | ||||||||||||
| PRIDE | O94875. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 8470. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000284776; ENSP00000284776; ENSG00000154556. ENST00000393528; ENSP00000377162; ENSG00000154556. ENST00000418609; ENSP00000397482; ENSG00000154556. ENST00000431808; ENSP00000411764; ENSG00000154556. ENST00000437304; ENSP00000396008; ENSG00000154556. ENST00000448662; ENSP00000409158; ENSG00000154556. ENST00000449407; ENSP00000397262; ENSG00000154556. | ||||||||||||
| GeneID | 8470. | ||||||||||||
| KEGG | hsa:8470. | ||||||||||||
| UCSC | uc003iya.3. human. uc003iyb.3. human. uc003iyc.3. human. uc003iyd.3. human. uc003iyf.3. human. uc003iyi.3. human. uc003iyl.3. human. uc011ckv.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 8470. | ||||||||||||
| GeneCards | GC04M186506. | ||||||||||||
| HGNC | HGNC:24098. SORBS2. | ||||||||||||
| HPA | HPA036754. | ||||||||||||
| neXtProt | NX_O94875. | ||||||||||||
| PharmGKB | PA142670890. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG256936. | ||||||||||||
| HOGENOM | HOG000294090. | ||||||||||||
| HOVERGEN | HBG108509. | ||||||||||||
| InParanoid | O94875. | ||||||||||||
| OrthoDB | EOG4J117C. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| SignaLink | O94875. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O94875. | ||||||||||||
| Bgee | O94875. | ||||||||||||
| CleanEx | HS_SORBS2. | ||||||||||||
| Genevestigator | O94875. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000108. p67phox. IPR011511. SH3_2. IPR001452. SH3_domain. IPR003127. Sorb. IPR007087. Znf_C2H2. [Graphical view] | ||||||||||||
| Pfam | PF00018. SH3_1. 2 hits. PF07653. SH3_2. 1 hit. PF02208. Sorb. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00499. P67PHOX. PR00452. SH3DOMAIN. | ||||||||||||
| SMART | SM00326. SH3. 3 hits. SM00459. Sorb. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50044. SH3. 3 hits. | ||||||||||||
| PROSITE | PS50002. SH3. 3 hits. PS50831. SOHO. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | SORBS2. human. | ||||||||||||
| GenomeRNAi | 8470. | ||||||||||||
| NextBio | 31696. | ||||||||||||
Entry information
| Entry name | SRBS2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94875 Secondary accession number(s): A6NEK9 Q96EX0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
