O94875 (SRBS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 90.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sorbin and SH3 domain-containing protein 2 Alternative name(s): Arg/Abl-interacting protein 2 Short name=ArgBP2 Sorbin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1100 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1 or with AKT1 and PAK1, thus mediating AKT1-mediated activation of PAK1. Isoform 6 increases water and sodium absorption in the intestine and gall-bladder. Ref.1 Ref.7 |
| Subunit structure | Interacts with ABL, CBL, DNM1, DNM2, FLOT1, MLLT4/afadin, PTK2B/PYK2, SAPAP, SPTAN1, SYNJ1, SYNJ2, VCL/vinculin, and WASF By similarity. Interacts with ABL1/c-Abl, ABL2/v-Abl/Arg, ACTN, AKT1, CBL, PALLD and PAK1. Ref.1 Ref.7 Ref.8 Ref.9 |
| Subcellular location | Cytoplasm › perinuclear region. Note: Found at the Z-disk sarcomeres, stress fibers, dense bodies and focal adhesion. Ref.1 Ref.8 |
| Tissue specificity | Abundantly expressed in heart. In cardiac muscle cells, located in the Z-disks of sarcomere. Also found, but to a lower extent, in small and large intestine, pancreas, thymus, colon, spleen, prostate, testis, brain, ovary and epithelial cells. Ref.1 Ref.2 |
| Post-translational modification | |
| Sequence similarities | Contains 3 SH3 domains. Contains 1 SoHo domain. |
| Sequence caution | The sequence BAA34497.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat SH3 domain |
| PTM | Amidation Phosphoprotein Ubl conjugation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | Z disc Non-traceable author statement Ref.1. Source: UniProtKB actin cytoskeletonTraceable author statement. Source: ProtInc nucleusNon-traceable author statement Ref.1. Source: UniProtKB perinuclear region of cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | cytoskeletal adaptor activity Traceable author statement. Source: ProtInc structural constituent of cytoskeletonTraceable author statement. Source: ProtInc structural constituent of muscleTraceable author statement. Source: ProtInc zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94875-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94875-2) Also known as: ArgBP2a; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNTGRDSQSPDSPKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM 228-228: P → PTDRINPDDIDLENEPWYKFFSELEFGRPPPKKPLDYVQDHSSGVFNE 308-834: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O94875-3) The sequence of this isoform differs from the canonical sequence as follows: 228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE 308-834: Missing. | ||||||
| Isoform 4 (identifier: O94875-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNTGRDSQSPDSPKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM 228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE 308-834: Missing. | ||||||
| Isoform 5 (identifier: O94875-5) Also known as: ArgBP2b; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNTGRDSQSPDSPKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM 228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE 308-834: Missing. 1050-1100: YNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL → GYTLT | ||||||
| Isoform 6 (identifier: O94875-6) Also known as: Sorbin; The sequence of this isoform differs from the canonical sequence as follows: 1-81: Missing. 82-89: GIPTAIRT → MKATTPLQ 229-237: ASLYQSSID → VSKPQAGRR 238-1100: Missing. | ||||||
| Note: Contains alanine amide at position 153. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1100 | 1100 | Sorbin and SH3 domain-containing protein 2 | PRO_0000344477 | |||||
Regions | |||||||||
| Domain | 66 – 127 | 62 | SoHo | ||||||
| Domain | 863 – 922 | 60 | SH3 1 | ||||||
| Domain | 938 – 999 | 62 | SH3 2 | ||||||
| Domain | 1041 – 1100 | 60 | SH3 3 | ||||||
| Compositional bias | 167 – 182 | 16 | Pro-rich | ||||||
| Compositional bias | 640 – 652 | 13 | His-rich | ||||||
| Compositional bias | 931 – 934 | 4 | Poly-Pro | ||||||
Amino acid modifications | |||||||||
| Modified residue | 30 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 154 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 157 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 259 | 1 | Phosphoserine Ref.10 Ref.12 | ||||||
| Modified residue | 277 | 1 | Phosphothreonine Ref.10 Ref.12 | ||||||
| Modified residue | 278 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 298 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 299 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 301 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||
| Modified residue | 302 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 371 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 376 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 750 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1017 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1018 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 81 | 81 | Missing in isoform 6. | VSP_034791 | |||||
| Alternative sequence | 1 | 1 | M → MNTGRDSQSPDSPKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 2, isoform 4 and isoform 5. | VSP_034792 | |||||
| Alternative sequence | 82 – 89 | 8 | GIPTAIRT → MKATTPLQ in isoform 6. | VSP_034793 | |||||
| Alternative sequence | 228 | 1 | P → PTDRINPDDIDLENEPWYKF FSELEFGRPPPKKPLDYVQD HSSGVFNE in isoform 2. | VSP_034794 | |||||
| Alternative sequence | 228 | 1 | P → PPPLPTTPTPVPREPGRKPL SSSRLGEVTGSPSPPPRSGA PTPSSRAPALSPTRPPKKPL DYVQDHSSGVFNE in isoform 3, isoform 4 and isoform 5. | VSP_034795 | |||||
| Alternative sequence | 229 – 237 | 9 | ASLYQSSID → VSKPQAGRR in isoform 6. | VSP_034796 | |||||
| Alternative sequence | 238 – 1100 | 863 | Missing in isoform 6. | VSP_034797 | |||||
| Alternative sequence | 308 – 834 | 527 | Missing in isoform 2, isoform 3, isoform 4 and isoform 5. | VSP_034798 | |||||
| Alternative sequence | 1050 – 1100 | 51 | YNYTP…YVKRL → GYTLT in isoform 5. | VSP_034799 | |||||
| Natural variant | 1048 | 1 | A → V. Corresponds to variant rs725185 [ dbSNP | Ensembl ]. | VAR_045624 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "ArgBP2, a multiple Src homology 3 domain-containing, Arg/Abl-interacting protein, is phosphorylated in v-Abl-transformed cells and localized in stress fibers and cardiocyte Z-disks." Wang B., Golemis E.A., Kruh G.D. J. Biol. Chem. 272:17542-17550(1997) [PubMed: 9211900] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 5), NUCLEOTIDE SEQUENCE [MRNA] OF 1-1049 (ISOFORM 4), PHOSPHORYLATION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH ABL1 AND ABL2, FUNCTION. Tissue: Brain. |
| [2] | "Coding region of the sorbin gene in different species." Wahbi K., Magaud J.-P., Pansu D., Descroix-Vagne M. Peptides 22:2045-2053(2001) [PubMed: 11786189] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), AMIDATION AT ALA-153 (ISOFORM 6), TISSUE SPECIFICITY. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:277-286(1998) [PubMed: 9872452] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Lymph. |
| [7] | "Cbl-ArgBP2 complex mediates ubiquitination and degradation of c-Abl." Soubeyran P., Barac A., Szymkiewicz I., Dikic I. Biochem. J. 370:29-34(2003) [PubMed: 12475393] [Abstract] Cited for: INTERACTION WITH CBL, UBIQUITINATION BY CBL, FUNCTION. |
| [8] | "Involvement of palladin and alpha-actinin in targeting of the Abl/Arg kinase adaptor ArgBP2 to the actin cytoskeleton." Roenty M., Taivainen A., Moza M., Kruh G.D., Ehler E., Carpen O. Exp. Cell Res. 310:88-98(2005) [PubMed: 16125169] [Abstract] Cited for: INTERACTION WITH PALLD AND ACTN, SUBCELLULAR LOCATION. |
| [9] | "ArgBP2gamma interacts with Akt and p21-activated kinase-1 and promotes cell survival." Yuan Z.-Q., Kim D., Kaneko S., Sussman M., Bokoch G.M., Kruh G.D., Nicosia S.V., Testa J.R., Cheng J.Q. J. Biol. Chem. 280:21483-21490(2005) [PubMed: 15784622] [Abstract] Cited for: INTERACTION WITH AKT1 AND PAK1, UBIQUITINATION BY CBL, PHOSPHORYLATION. |
| [10] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-259 AND THR-277, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-301, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157; SER-259; THR-277; SER-299; SER-301 AND SER-302, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF049884 mRNA. Translation: AAC05508.1. AF049885 mRNA. Translation: AAC05509.1. AB018320 mRNA. Translation: BAA34497.2. Different initiation. AC093797 Genomic DNA. No translation available. CH471056 Genomic DNA. Translation: EAX04630.1. CH471056 Genomic DNA. Translation: EAX04631.1. CH471056 Genomic DNA. Translation: EAX04632.1. CH471056 Genomic DNA. Translation: EAX04635.1. BC011883 mRNA. Translation: AAH11883.1. |
| IPI | IPI00477577. IPI00747799. IPI00787549. IPI00900281. IPI00900295. IPI01013920. |
| RefSeq | NP_001139142.1. NM_001145670.1. NP_001139143.1. NM_001145671.1. NP_001139144.1. NM_001145672.1. NP_001139145.1. NM_001145673.1. NP_003594.3. NM_003603.5. NP_066547.1. NM_021069.4. |
| UniGene | Hs.619806. Hs.655143. |
3D structure databases | |
| HSSP | HSSP built from PDB template 2CT3 based on UniProtKB O60504. |
| ProteinModelPortal | O94875. |
| SMR | O94875. Positions 866-1100. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-31634N. |
| IntAct | O94875. 8 interactions. |
| MINT | MINT-196404. |
| STRING | O94875. |
PTM databases | |
| PhosphoSite | O94875. |
Proteomic databases | |
| PRIDE | O94875. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000284776; ENSP00000284776; ENSG00000154556. ENST00000355634; ENSP00000347852; ENSG00000154556. ENST00000431808; ENSP00000411764; ENSG00000154556. ENST00000447992; ENSP00000415118; ENSG00000154556. |
| GeneID | 8470. |
| KEGG | hsa:8470. |
Organism-specific databases | |
| CTD | 8470. |
| GeneCards | GC04M186506. |
| HGNC | HGNC:24098. SORBS2. |
| HPA | HPA036754. |
| neXtProt | NX_O94875. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG17281. |
| GeneTree | ENSGT00550000074287. |
| HOVERGEN | HBG108509. |
| InParanoid | O94875. |
| OrthoDB | EOG4J117C. |
Gene expression databases | |
| ArrayExpress | O94875. |
| Bgee | O94875. |
| CleanEx | HS_SORBS2. |
| Genevestigator | O94875. |
Family and domain databases | |
| InterPro | IPR000108. p67phox. IPR001452. SH3_domain. IPR003127. Sorb. IPR007087. Znf_C2H2. [Graphical view] |
| Pfam | PF00018. SH3_1. 3 hits. PF02208. Sorb. 1 hit. [Graphical view] |
| PRINTS | PR00499. P67PHOX. PR00452. SH3DOMAIN. |
| SMART | SM00326. SH3. 3 hits. SM00459. Sorb. 1 hit. [Graphical view] |
| SUPFAM | SSF50044. SH3. 3 hits. |
| PROSITE | PS50002. SH3. 3 hits. PS50831. SOHO. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 31696. |
Entry information
| Entry name | SRBS2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94875 Secondary accession number(s): A6NEK9 Q96EX0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with