Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O94875

- SRBS2_HUMAN

UniProt

O94875 - SRBS2_HUMAN

Protein

Sorbin and SH3 domain-containing protein 2

Gene

SORBS2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 121 (01 Oct 2014)
      Sequence version 3 (22 Jul 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1 or with AKT1 and PAK1, thus mediating AKT1-mediated activation of PAK1. Isoform 6 increases water and sodium absorption in the intestine and gall-bladder.2 Publications

    GO - Molecular functioni

    1. cytoskeletal adaptor activity Source: ProtInc
    2. metal ion binding Source: InterPro
    3. poly(A) RNA binding Source: UniProtKB
    4. protein binding Source: IntAct
    5. structural constituent of cytoskeleton Source: ProtInc
    6. structural constituent of muscle Source: ProtInc

    GO - Biological processi

    1. actin filament organization Source: InterPro
    2. cell adhesion Source: InterPro
    3. cell migration Source: InterPro

    Enzyme and pathway databases

    SignaLinkiO94875.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sorbin and SH3 domain-containing protein 2
    Alternative name(s):
    Arg/Abl-interacting protein 2
    Short name:
    ArgBP2
    Sorbin
    Gene namesi
    Name:SORBS2
    Synonyms:ARGBP2, KIAA0777
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:24098. SORBS2.

    Subcellular locationi

    Cytoplasmperinuclear region 2 Publications
    Note: Found at the Z-disk sarcomeres, stress fibers, dense bodies and focal adhesion.

    GO - Cellular componenti

    1. actin cytoskeleton Source: ProtInc
    2. nucleus Source: UniProtKB
    3. perinuclear region of cytoplasm Source: UniProtKB-SubCell
    4. plasma membrane Source: Ensembl
    5. Z disc Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142670890.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 11001100Sorbin and SH3 domain-containing protein 2PRO_0000344477Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei157 – 1571Phosphoserine2 Publications
    Modified residuei259 – 2591PhosphoserineBy similarity
    Modified residuei277 – 2771Phosphothreonine1 Publication
    Modified residuei298 – 2981Phosphoserine1 Publication
    Modified residuei299 – 2991Phosphoserine1 Publication
    Modified residuei301 – 3011Phosphoserine1 Publication
    Modified residuei302 – 3021Phosphoserine2 Publications
    Modified residuei750 – 7501PhosphoserineBy similarity
    Modified residuei1017 – 10171PhosphoserineBy similarity

    Post-translational modificationi

    Ubiquitinated by CBL.2 Publications

    Keywords - PTMi

    Amidation, Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiO94875.
    PaxDbiO94875.
    PRIDEiO94875.

    PTM databases

    PhosphoSiteiO94875.

    Expressioni

    Tissue specificityi

    Abundantly expressed in heart. In cardiac muscle cells, located in the Z-disks of sarcomere. Also found, but to a lower extent, in small and large intestine, pancreas, thymus, colon, spleen, prostate, testis, brain, ovary and epithelial cells.2 Publications

    Gene expression databases

    ArrayExpressiO94875.
    BgeeiO94875.
    CleanExiHS_SORBS2.
    GenevestigatoriO94875.

    Organism-specific databases

    HPAiHPA036754.
    HPA036755.

    Interactioni

    Subunit structurei

    Interacts with ABL, CBL, DNM1, DNM2, FLOT1, MLLT4/afadin, PTK2B/PYK2, SAPAP, SPTAN1, SYNJ1, SYNJ2, VCL/vinculin, and WASF By similarity. Interacts with ABL1/c-Abl, ABL2/v-Abl/Arg, ACTN, AKT1, CBL, PALLD and PAK1.By similarity4 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Q9WMX22EBI-311323,EBI-6863748From a different organism.
    PAK2Q131772EBI-311323,EBI-1045887
    PALLDQ8WX932EBI-311323,EBI-2803991
    YWHAZP631042EBI-311323,EBI-347088

    Protein-protein interaction databases

    BioGridi114047. 28 interactions.
    DIPiDIP-31634N.
    IntActiO94875. 18 interactions.
    MINTiMINT-196404.
    STRINGi9606.ENSP00000284776.

    Structurei

    Secondary structure

    1
    1100
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi866 – 8727
    Beta strandi889 – 90517
    Beta strandi908 – 9136
    Helixi914 – 9163
    Beta strandi917 – 9193

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    4IGZX-ray1.33A866-921[»]
    ProteinModelPortaliO94875.
    SMRiO94875. Positions 855-1100.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini66 – 12762SoHoPROSITE-ProRule annotationAdd
    BLAST
    Domaini863 – 92260SH3 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini938 – 99962SH3 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1041 – 110060SH3 3PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi167 – 18216Pro-richAdd
    BLAST
    Compositional biasi640 – 65213His-richAdd
    BLAST
    Compositional biasi931 – 9344Poly-Pro

    Sequence similaritiesi

    Contains 3 SH3 domains.PROSITE-ProRule annotation
    Contains 1 SoHo domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, SH3 domain

    Phylogenomic databases

    eggNOGiNOG256936.
    HOGENOMiHOG000294090.
    HOVERGENiHBG108509.
    InParanoidiO94875.
    OMAiPREPGRK.
    OrthoDBiEOG7FFMQT.
    PhylomeDBiO94875.
    TreeFamiTF320680.

    Family and domain databases

    InterProiIPR028516. ArgBP2.
    IPR001452. SH3_domain.
    IPR003127. Sorb.
    IPR007087. Znf_C2H2.
    [Graphical view]
    PANTHERiPTHR10661:SF122. PTHR10661:SF122. 1 hit.
    PfamiPF00018. SH3_1. 2 hits.
    PF14604. SH3_9. 1 hit.
    PF02208. Sorb. 1 hit.
    [Graphical view]
    PRINTSiPR00452. SH3DOMAIN.
    SMARTiSM00326. SH3. 3 hits.
    SM00459. Sorb. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 3 hits.
    PROSITEiPS50002. SH3. 3 hits.
    PS50831. SOHO. 1 hit.
    [Graphical view]

    Sequences (12)i

    Sequence statusi: Complete.

    This entry describes 12 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O94875-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSYYQRPFSP SAYSLPASLN SSIVMQHGTS LDSTDTYPQH AQSLDGTTSS     50
    SIPLYRSSEE EKRVTVIKAP HYPGIGPVDE SGIPTAIRTT VDRPKDWYKT 100
    MFKQIHMVHK PDDDTDMYNT PYTYNAGLYN PPYSAQSHPA AKTQTYRPLS 150
    KSHSDNSPNA FKDASSPVPP PHVPPPVPPL RPRDRSSTEK HDWDPPDRKV 200
    DTRKFRSEPR SIFEYEPGKS SILQHERPAS LYQSSIDRSL ERPMSSASMA 250
    SDFRKRRKSE PAVGPPRGLG DQSASRTSPG RVDLPGSSTT LTKSFTSSSP 300
    SSPSRAKGGD DSKICPSLCS YSGLNGNPSS ELDYCSTYRQ HLDVPRDSPR 350
    AISFKNGWQM ARQNAEIWSS TEETVSPKIK SRSCDDLLND DCDSFPDPKV 400
    KSESMGSLLC EEDSKESCPM AWGSPYVPEV RSNGRSRIRH RSARNAPGFL 450
    KMYKKMHRIN RKDLMNSEVI CSVKSRILQY ESEQQHKDLL RAWSQCSTEE 500
    VPRDMVPTRI SEFEKLIQKS KSMPNLGDDM LSPVTLEPPQ NGLCPKRRFS 550
    IEYLLEEENQ SGPPARGRRG CQSNALVPIH IEVTSDEQPR AHVEFSDSDQ 600
    DGVVSDHSDY IHLEGSSFCS ESDFDHFSFT SSESFYGSSH HHHHHHHHHH 650
    RHLISSCKGR CPASYTRFTT MLKHERARHE NTEEPRRQEM DPGLSKLAFL 700
    VSPVPFRRKK NSAPKKQTEK AKCKASVFEA LDSALKDICD QIKAEKKRGS 750
    LPDNSILHRL ISELLPDVPE RNSSLRALRR SPLHQPLHPL PPDGAIHCPP 800
    YQNDCGRMPR SASFQDVDTA NSSCHHQDRG GALQDRESPR SYSSTLTDMG 850
    RSAPRERRGT PEKEKLPAKA VYDFKAQTSK ELSFKKGDTV YILRKIDQNW 900
    YEGEHHGRVG IFPISYVEKL TPPEKAQPAR PPPPAQPGEI GEAIAKYNFN 950
    ADTNVELSLR KGDRVILLKR VDQNWYEGKI PGTNRQGIFP VSYVEVVKKN 1000
    TKGAEDYPDP PIPHSYSSDR IHSLSSNKPQ RPVFTHENIQ GGGEPFQALY 1050
    NYTPRNEDEL ELRESDVIDV MEKCDDGWFV GTSRRTKFFG TFPGNYVKRL 1100
    Length:1,100
    Mass (Da):124,108
    Last modified:July 22, 2008 - v3
    Checksum:i7E98B196D4DB38E6
    GO
    Isoform 2 (identifier: O94875-2) [UniParc]FASTAAdd to Basket

    Also known as: ArgBP2a

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
         228-228: P → PTDRINPDDIDLENEPWYKFFSELEFGRPPPKKPLDYVQDHSSGVFNE
         308-834: Missing.

    Show »
    Length:666
    Mass (Da):74,778
    Checksum:i92504C18534CD94B
    GO
    Isoform 3 (identifier: O94875-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
         308-834: Missing.

    Note: Contains a phosphoserine at position 258. Contains a phosphoserine at position 260.

    Show »
    Length:645
    Mass (Da):71,899
    Checksum:i8CDEF6E34D5F972F
    GO
    Isoform 4 (identifier: O94875-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
         228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
         308-834: Missing.

    Note: Contains a phosphoserine at position 304. Contains a phosphoserine at position 306.

    Show »
    Length:691
    Mass (Da):76,712
    Checksum:i1CF7D8E8E49233B8
    GO
    Isoform 5 (identifier: O94875-5) [UniParc]FASTAAdd to Basket

    Also known as: ArgBP2b

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
         228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
         308-834: Missing.
         1050-1100: YNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL → GYTLT

    Note: Contains a phosphoserine at position 304. Contains a phosphoserine at position 306.Curated

    Show »
    Length:645
    Mass (Da):71,170
    Checksum:i455C7808CED30D41
    GO
    Isoform 6 (identifier: O94875-6) [UniParc]FASTAAdd to Basket

    Also known as: Sorbin

    The sequence of this isoform differs from the canonical sequence as follows:
         1-81: Missing.
         82-89: GIPTAIRT → MKATTPLQ
         229-237: ASLYQSSID → VSKPQAGRR
         238-1100: Missing.

    Note: Contains a alanine amide at position 153.

    Show »
    Length:156
    Mass (Da):17,976
    Checksum:i95AE8B49881FCC12
    GO
    Isoform 7 (identifier: O94875-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-89: MSYYQRPFSP...ESGIPTAIRT → MKATTPLQ
         112-126: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,004
    Mass (Da):113,555
    Checksum:i1D2245E4FC6037EB
    GO
    Isoform 8 (identifier: O94875-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MNTGRDSQSPDSAWRSYNDGNQETLNGDATYSSLAAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
         228-228: P → PPPKKPLDYVQDHSSGVFNE
         308-834: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:661
    Mass (Da):73,868
    Checksum:iD72A9CE26ADB7BAD
    GO
    Isoform 9 (identifier: O94875-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSVTLTSVKR...GNSGGAVSPM
         112-126: Missing.
         308-834: Missing.

    Note: No experimental confirmation available. Contains a phosphoserine at position 14.

    Show »
    Length:644
    Mass (Da):71,686
    Checksum:i19886F6C073CEB1E
    GO
    Isoform 10 (identifier: O94875-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MYSNEDSRQT...GNSGGAVSPM
         228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
         308-834: Missing.

    Note: No experimental confirmation available.Curated Contains a phosphoserine at position 437. Contains a phosphoserine at position 439.Curated

    Show »
    Length:824
    Mass (Da):91,277
    Checksum:iEB10B42B47D6751B
    GO
    Isoform 11 (identifier: O94875-11) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MNTDSGGCAR...GNSGGAVSPM

    Note: Contains a phosphoserine at position 28.

    Show »
    Length:1,200
    Mass (Da):134,594
    Checksum:i836875AFD6649C8B
    GO
    Isoform 12 (identifier: O94875-12) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSVTLTSVKR...GNSGGAVSPM
         228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
         308-834: Missing.

    Note: Contains a phosphoserine at position 344. Contains a phosphoserine at position 346. Contains a phosphoserine at position 14.

    Show »
    Length:731
    Mass (Da):80,966
    Checksum:iC98B891C2124E1F7
    GO

    Sequence cautioni

    The sequence BAA34497.2 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti73 – 731P → L in AK225327. 1 PublicationCurated
    Sequence conflicti206 – 2061R → Q in AK225327. 1 PublicationCurated
    Sequence conflicti231 – 2311L → S in BAG51769. (PubMed:14702039)Curated
    Sequence conflicti536 – 5361L → P in BAG51769. (PubMed:14702039)Curated
    Sequence conflicti891 – 8911Y → N in BAG51769. (PubMed:14702039)Curated
    Sequence conflicti1034 – 10341F → L in BAH11501. (PubMed:14702039)Curated
    Isoform 2 (identifier: O94875-2)
    Sequence conflicti13 – 131A → P in AAC05509. (PubMed:9211900)Curated
    Isoform 5 (identifier: O94875-5)
    Sequence conflicti13 – 131A → P in AAC05508. (PubMed:9211900)Curated
    Isoform 10 (identifier: O94875-10)
    Sequence conflicti424 – 4241K → E in AK225812. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti1048 – 10481A → V.
    Corresponds to variant rs725185 [ dbSNP | Ensembl ].
    VAR_045624

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8989MSYYQ…TAIRT → MKATTPLQ in isoform 7. 1 PublicationVSP_043665Add
    BLAST
    Alternative sequencei1 – 8181Missing in isoform 6. 1 PublicationVSP_034791Add
    BLAST
    Alternative sequencei1 – 11M → MYSNEDSRQTIVYSEESNTT MSYTQKITNPLPAASSTDPA PFANINTPVLQEDYRQDSQT RRISTLKLTHNQDLGSSSPI STPQFSKSVEVPSFLKRPRS LTPNPVPETHTASLSIQIAP LSGQDLESHKQLPELSPETA KIPLQQERQKSAVAAASQSS DCRVSQITVNGNSGGAVSPM in isoform 10. 1 PublicationVSP_046220
    Alternative sequencei1 – 11M → MNTDSGGCARKRAAMSVTLT SVKRVQSSPNLLAAGRDSQS PDSAWRSYNDGNQETLNGDA TYSSLAAKGFRSVRPNLQDK RSPTQSQITVNGNSGGAVSP M in isoform 11. 1 PublicationVSP_047056
    Alternative sequencei1 – 11M → MNTGRDSQSPDSAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 2, isoform 4 and isoform 5. 1 PublicationVSP_034792
    Alternative sequencei1 – 11M → MNTGRDSQSPDSAWRSYNDG NQETLNGDATYSSLAAKGFR SVRPNLQDKRSPTQSQITVN GNSGGAVSPM in isoform 8. 1 PublicationVSP_045640
    Alternative sequencei1 – 11M → MSVTLTSVKRVQSSPNLLAA GRDSQSPDSAWRSYNDGNQE TLNGDATYSSLAAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 9 and isoform 12. 1 PublicationVSP_046219
    Alternative sequencei82 – 898GIPTAIRT → MKATTPLQ in isoform 6. 1 PublicationVSP_034793
    Alternative sequencei112 – 12615Missing in isoform 7 and isoform 9. 2 PublicationsVSP_043666Add
    BLAST
    Alternative sequencei228 – 2281P → PTDRINPDDIDLENEPWYKF FSELEFGRPPPKKPLDYVQD HSSGVFNE in isoform 2. 1 PublicationVSP_034794
    Alternative sequencei228 – 2281P → PPPLPTTPTPVPREPGRKPL SSSRLGEVTGSPSPPPRSGA PTPSSRAPALSPTRPPKKPL DYVQDHSSGVFNE in isoform 3, isoform 4, isoform 5, isoform 10 and isoform 12. 3 PublicationsVSP_034795
    Alternative sequencei228 – 2281P → PPPKKPLDYVQDHSSGVFNE in isoform 8. 1 PublicationVSP_045641
    Alternative sequencei229 – 2379ASLYQSSID → VSKPQAGRR in isoform 6. 1 PublicationVSP_034796
    Alternative sequencei238 – 1100863Missing in isoform 6. 1 PublicationVSP_034797Add
    BLAST
    Alternative sequencei308 – 834527Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 8, isoform 9, isoform 10 and isoform 12. 4 PublicationsVSP_034798Add
    BLAST
    Alternative sequencei1050 – 110051YNYTP…YVKRL → GYTLT in isoform 5. 1 PublicationVSP_034799Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF049884 mRNA. Translation: AAC05508.1.
    AF049885 mRNA. Translation: AAC05509.1.
    AB018320 mRNA. Translation: BAA34497.2. Different initiation.
    AK056628 mRNA. Translation: BAG51769.1.
    AK293400 mRNA. Translation: BAH11501.1.
    AK296461 mRNA. Translation: BAH12362.1.
    AK225327 mRNA. No translation available.
    AK225812 mRNA. No translation available.
    AC093797 Genomic DNA. No translation available.
    AC096659 Genomic DNA. No translation available.
    AC104805 Genomic DNA. No translation available.
    AC108472 Genomic DNA. No translation available.
    CH471056 Genomic DNA. Translation: EAX04630.1.
    CH471056 Genomic DNA. Translation: EAX04631.1.
    CH471056 Genomic DNA. Translation: EAX04632.1.
    CH471056 Genomic DNA. Translation: EAX04635.1.
    CH471056 Genomic DNA. Translation: EAX04636.1.
    BC011883 mRNA. Translation: AAH11883.1.
    CCDSiCCDS3845.1. [O94875-1]
    CCDS43289.2. [O94875-2]
    CCDS47173.1. [O94875-9]
    CCDS47174.1. [O94875-12]
    CCDS47175.1. [O94875-10]
    CCDS47176.1. [O94875-7]
    CCDS54825.1. [O94875-8]
    CCDS59482.1. [O94875-11]
    RefSeqiNP_001139142.1. NM_001145670.1. [O94875-9]
    NP_001139143.1. NM_001145671.2. [O94875-12]
    NP_001139144.1. NM_001145672.1. [O94875-8]
    NP_001139145.1. NM_001145673.1. [O94875-10]
    NP_001139146.1. NM_001145674.1. [O94875-7]
    NP_001257700.1. NM_001270771.1. [O94875-11]
    NP_003594.3. NM_003603.6. [O94875-2]
    NP_066547.1. NM_021069.4. [O94875-1]
    XP_005263369.1. XM_005263312.1. [O94875-4]
    XP_006714453.1. XM_006714390.1. [O94875-8]
    UniGeneiHs.619806.
    Hs.655143.

    Genome annotation databases

    EnsembliENST00000284776; ENSP00000284776; ENSG00000154556. [O94875-1]
    ENST00000319471; ENSP00000322182; ENSG00000154556. [O94875-12]
    ENST00000355634; ENSP00000347852; ENSG00000154556. [O94875-11]
    ENST00000393528; ENSP00000377162; ENSG00000154556. [O94875-2]
    ENST00000418609; ENSP00000397482; ENSG00000154556. [O94875-7]
    ENST00000437304; ENSP00000396008; ENSG00000154556. [O94875-10]
    ENST00000448662; ENSP00000409158; ENSG00000154556. [O94875-8]
    ENST00000449407; ENSP00000397262; ENSG00000154556. [O94875-9]
    GeneIDi8470.
    KEGGihsa:8470.
    UCSCiuc003iya.3. human.
    uc003iyb.3. human. [O94875-3]
    uc003iyl.3. human. [O94875-1]
    uc011ckv.2. human. [O94875-7]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF049884 mRNA. Translation: AAC05508.1 .
    AF049885 mRNA. Translation: AAC05509.1 .
    AB018320 mRNA. Translation: BAA34497.2 . Different initiation.
    AK056628 mRNA. Translation: BAG51769.1 .
    AK293400 mRNA. Translation: BAH11501.1 .
    AK296461 mRNA. Translation: BAH12362.1 .
    AK225327 mRNA. No translation available.
    AK225812 mRNA. No translation available.
    AC093797 Genomic DNA. No translation available.
    AC096659 Genomic DNA. No translation available.
    AC104805 Genomic DNA. No translation available.
    AC108472 Genomic DNA. No translation available.
    CH471056 Genomic DNA. Translation: EAX04630.1 .
    CH471056 Genomic DNA. Translation: EAX04631.1 .
    CH471056 Genomic DNA. Translation: EAX04632.1 .
    CH471056 Genomic DNA. Translation: EAX04635.1 .
    CH471056 Genomic DNA. Translation: EAX04636.1 .
    BC011883 mRNA. Translation: AAH11883.1 .
    CCDSi CCDS3845.1. [O94875-1 ]
    CCDS43289.2. [O94875-2 ]
    CCDS47173.1. [O94875-9 ]
    CCDS47174.1. [O94875-12 ]
    CCDS47175.1. [O94875-10 ]
    CCDS47176.1. [O94875-7 ]
    CCDS54825.1. [O94875-8 ]
    CCDS59482.1. [O94875-11 ]
    RefSeqi NP_001139142.1. NM_001145670.1. [O94875-9 ]
    NP_001139143.1. NM_001145671.2. [O94875-12 ]
    NP_001139144.1. NM_001145672.1. [O94875-8 ]
    NP_001139145.1. NM_001145673.1. [O94875-10 ]
    NP_001139146.1. NM_001145674.1. [O94875-7 ]
    NP_001257700.1. NM_001270771.1. [O94875-11 ]
    NP_003594.3. NM_003603.6. [O94875-2 ]
    NP_066547.1. NM_021069.4. [O94875-1 ]
    XP_005263369.1. XM_005263312.1. [O94875-4 ]
    XP_006714453.1. XM_006714390.1. [O94875-8 ]
    UniGenei Hs.619806.
    Hs.655143.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    4IGZ X-ray 1.33 A 866-921 [» ]
    ProteinModelPortali O94875.
    SMRi O94875. Positions 855-1100.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114047. 28 interactions.
    DIPi DIP-31634N.
    IntActi O94875. 18 interactions.
    MINTi MINT-196404.
    STRINGi 9606.ENSP00000284776.

    PTM databases

    PhosphoSitei O94875.

    Proteomic databases

    MaxQBi O94875.
    PaxDbi O94875.
    PRIDEi O94875.

    Protocols and materials databases

    DNASUi 8470.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000284776 ; ENSP00000284776 ; ENSG00000154556 . [O94875-1 ]
    ENST00000319471 ; ENSP00000322182 ; ENSG00000154556 . [O94875-12 ]
    ENST00000355634 ; ENSP00000347852 ; ENSG00000154556 . [O94875-11 ]
    ENST00000393528 ; ENSP00000377162 ; ENSG00000154556 . [O94875-2 ]
    ENST00000418609 ; ENSP00000397482 ; ENSG00000154556 . [O94875-7 ]
    ENST00000437304 ; ENSP00000396008 ; ENSG00000154556 . [O94875-10 ]
    ENST00000448662 ; ENSP00000409158 ; ENSG00000154556 . [O94875-8 ]
    ENST00000449407 ; ENSP00000397262 ; ENSG00000154556 . [O94875-9 ]
    GeneIDi 8470.
    KEGGi hsa:8470.
    UCSCi uc003iya.3. human.
    uc003iyb.3. human. [O94875-3 ]
    uc003iyl.3. human. [O94875-1 ]
    uc011ckv.2. human. [O94875-7 ]

    Organism-specific databases

    CTDi 8470.
    GeneCardsi GC04M186506.
    HGNCi HGNC:24098. SORBS2.
    HPAi HPA036754.
    HPA036755.
    neXtProti NX_O94875.
    PharmGKBi PA142670890.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG256936.
    HOGENOMi HOG000294090.
    HOVERGENi HBG108509.
    InParanoidi O94875.
    OMAi PREPGRK.
    OrthoDBi EOG7FFMQT.
    PhylomeDBi O94875.
    TreeFami TF320680.

    Enzyme and pathway databases

    SignaLinki O94875.

    Miscellaneous databases

    ChiTaRSi SORBS2. human.
    GeneWikii SORBS2.
    GenomeRNAii 8470.
    NextBioi 31696.
    PROi O94875.

    Gene expression databases

    ArrayExpressi O94875.
    Bgeei O94875.
    CleanExi HS_SORBS2.
    Genevestigatori O94875.

    Family and domain databases

    InterProi IPR028516. ArgBP2.
    IPR001452. SH3_domain.
    IPR003127. Sorb.
    IPR007087. Znf_C2H2.
    [Graphical view ]
    PANTHERi PTHR10661:SF122. PTHR10661:SF122. 1 hit.
    Pfami PF00018. SH3_1. 2 hits.
    PF14604. SH3_9. 1 hit.
    PF02208. Sorb. 1 hit.
    [Graphical view ]
    PRINTSi PR00452. SH3DOMAIN.
    SMARTi SM00326. SH3. 3 hits.
    SM00459. Sorb. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 3 hits.
    PROSITEi PS50002. SH3. 3 hits.
    PS50831. SOHO. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "ArgBP2, a multiple Src homology 3 domain-containing, Arg/Abl-interacting protein, is phosphorylated in v-Abl-transformed cells and localized in stress fibers and cardiocyte Z-disks."
      Wang B., Golemis E.A., Kruh G.D.
      J. Biol. Chem. 272:17542-17550(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 5), NUCLEOTIDE SEQUENCE [MRNA] OF 1-1049 (ISOFORM 4), PHOSPHORYLATION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH ABL1 AND ABL2, FUNCTION.
      Tissue: Brain.
    2. "Coding region of the sorbin gene in different species."
      Wahbi K., Magaud J.-P., Pansu D., Descroix-Vagne M.
      Peptides 22:2045-2053(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), AMIDATION AT ALA-153 (ISOFORM 6), TISSUE SPECIFICITY.
    3. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 7; 8 AND 11).
      Tissue: Embryonic brain, Thalamus and Urinary bladder.
    5. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 9 AND 10).
      Tissue: Heart and Hepatoma.
    6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Lymph.
    9. "Cbl-ArgBP2 complex mediates ubiquitination and degradation of c-Abl."
      Soubeyran P., Barac A., Szymkiewicz I., Dikic I.
      Biochem. J. 370:29-34(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CBL, UBIQUITINATION BY CBL, FUNCTION.
    10. "Involvement of palladin and alpha-actinin in targeting of the Abl/Arg kinase adaptor ArgBP2 to the actin cytoskeleton."
      Roenty M., Taivainen A., Moza M., Kruh G.D., Ehler E., Carpen O.
      Exp. Cell Res. 310:88-98(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH PALLD AND ACTN, SUBCELLULAR LOCATION.
    11. "ArgBP2gamma interacts with Akt and p21-activated kinase-1 and promotes cell survival."
      Yuan Z.-Q., Kim D., Kaneko S., Sussman M., Bokoch G.M., Kruh G.D., Nicosia S.V., Testa J.R., Cheng J.Q.
      J. Biol. Chem. 280:21483-21490(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH AKT1 AND PAK1, UBIQUITINATION BY CBL, PHOSPHORYLATION.
    12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157; THR-277; SER-301 AND SER-302, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-437 AND SER-439 (ISOFORM 10), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344 AND SER-346 (ISOFORM 12), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 AND SER-260 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304 AND SER-306 (ISOFORMS 4 AND 5), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157; SER-298; SER-299 AND SER-302, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-437 AND SER-439 (ISOFORM 10), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-28 (ISOFORM 11), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344 AND SER-346 (ISOFORM 12), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14 (ISOFORMS 12 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 AND SER-260 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304 AND SER-306 (ISOFORMS 4 AND 5), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiSRBS2_HUMAN
    AccessioniPrimary (citable) accession number: O94875
    Secondary accession number(s): A6NEK9
    , B3KPQ7, B7Z1G5, B7Z3X6, C9JKV9, D3DP62, D3DP63, E9PAS5, E9PAW4, G3XAI0, H7BXR4, J3KNZ5, O60592, O60593, Q96EX0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 22, 2008
    Last sequence update: July 22, 2008
    Last modified: October 1, 2014
    This is version 121 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3