Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O94875 (SRBS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 119. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sorbin and SH3 domain-containing protein 2
Alternative name(s):
Arg/Abl-interacting protein 2
Short name=ArgBP2
Sorbin
Gene names
Name:SORBS2
Synonyms:ARGBP2, KIAA0777
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1100 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1 or with AKT1 and PAK1, thus mediating AKT1-mediated activation of PAK1. Isoform 6 increases water and sodium absorption in the intestine and gall-bladder. Ref.1 Ref.9

Subunit structure

Interacts with ABL, CBL, DNM1, DNM2, FLOT1, MLLT4/afadin, PTK2B/PYK2, SAPAP, SPTAN1, SYNJ1, SYNJ2, VCL/vinculin, and WASF By similarity. Interacts with ABL1/c-Abl, ABL2/v-Abl/Arg, ACTN, AKT1, CBL, PALLD and PAK1. Ref.1 Ref.9 Ref.10 Ref.11

Subcellular location

Cytoplasmperinuclear region. Note: Found at the Z-disk sarcomeres, stress fibers, dense bodies and focal adhesion. Ref.1 Ref.10

Tissue specificity

Abundantly expressed in heart. In cardiac muscle cells, located in the Z-disks of sarcomere. Also found, but to a lower extent, in small and large intestine, pancreas, thymus, colon, spleen, prostate, testis, brain, ovary and epithelial cells. Ref.1 Ref.2

Post-translational modification

Ubiquitinated by CBL. Ref.9 Ref.11

Sequence similarities

Contains 3 SH3 domains.

Contains 1 SoHo domain.

Sequence caution

The sequence BAA34497.2 differs from that shown. Reason: Erroneous initiation.

Binary interactions

Alternative products

This entry describes 12 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O94875-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O94875-2)

Also known as: ArgBP2a;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PTDRINPDDIDLENEPWYKFFSELEFGRPPPKKPLDYVQDHSSGVFNE
     308-834: Missing.
Isoform 3 (identifier: O94875-3)

The sequence of this isoform differs from the canonical sequence as follows:
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.
Note: Contains a phosphoserine at position 258. Contains a phosphoserine at position 260.
Isoform 4 (identifier: O94875-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.
Note: Contains a phosphoserine at position 304. Contains a phosphoserine at position 306.
Isoform 5 (identifier: O94875-5)

Also known as: ArgBP2b;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.
     1050-1100: YNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL → GYTLT
Note: Contains a phosphoserine at position 304. Contains a phosphoserine at position 306.
Isoform 6 (identifier: O94875-6)

Also known as: Sorbin;

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     82-89: GIPTAIRT → MKATTPLQ
     229-237: ASLYQSSID → VSKPQAGRR
     238-1100: Missing.
Note: Contains a alanine amide at position 153.
Isoform 7 (identifier: O94875-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MSYYQRPFSP...ESGIPTAIRT → MKATTPLQ
     112-126: Missing.
Note: No experimental confirmation available.
Isoform 8 (identifier: O94875-8)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAWRSYNDGNQETLNGDATYSSLAAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPKKPLDYVQDHSSGVFNE
     308-834: Missing.
Note: No experimental confirmation available.
Isoform 9 (identifier: O94875-9)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSVTLTSVKR...GNSGGAVSPM
     112-126: Missing.
     308-834: Missing.
Note: No experimental confirmation available. Contains a phosphoserine at position 14.
Isoform 10 (identifier: O94875-10)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYSNEDSRQT...GNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.
Note: No experimental confirmation available. Contains a phosphoserine at position 437. Contains a phosphoserine at position 439.
Isoform 11 (identifier: O94875-11)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTDSGGCAR...GNSGGAVSPM
Note: Contains a phosphoserine at position 28.
Isoform 12 (identifier: O94875-12)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSVTLTSVKR...GNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.
Note: Contains a phosphoserine at position 344. Contains a phosphoserine at position 346. Contains a phosphoserine at position 14.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 11001100Sorbin and SH3 domain-containing protein 2
PRO_0000344477

Regions

Domain66 – 12762SoHo
Domain863 – 92260SH3 1
Domain938 – 99962SH3 2
Domain1041 – 110060SH3 3
Compositional bias167 – 18216Pro-rich
Compositional bias640 – 65213His-rich
Compositional bias931 – 9344Poly-Pro

Amino acid modifications

Modified residue1571Phosphoserine Ref.12 Ref.13
Modified residue2591Phosphoserine By similarity
Modified residue2771Phosphothreonine Ref.12
Modified residue2981Phosphoserine Ref.13
Modified residue2991Phosphoserine Ref.13
Modified residue3011Phosphoserine Ref.12
Modified residue3021Phosphoserine Ref.12 Ref.13
Modified residue7501Phosphoserine By similarity
Modified residue10171Phosphoserine By similarity

Natural variations

Alternative sequence1 – 8989MSYYQ…TAIRT → MKATTPLQ in isoform 7.
VSP_043665
Alternative sequence1 – 8181Missing in isoform 6.
VSP_034791
Alternative sequence11M → MYSNEDSRQTIVYSEESNTT MSYTQKITNPLPAASSTDPA PFANINTPVLQEDYRQDSQT RRISTLKLTHNQDLGSSSPI STPQFSKSVEVPSFLKRPRS LTPNPVPETHTASLSIQIAP LSGQDLESHKQLPELSPETA KIPLQQERQKSAVAAASQSS DCRVSQITVNGNSGGAVSPM in isoform 10.
VSP_046220
Alternative sequence11M → MNTDSGGCARKRAAMSVTLT SVKRVQSSPNLLAAGRDSQS PDSAWRSYNDGNQETLNGDA TYSSLAAKGFRSVRPNLQDK RSPTQSQITVNGNSGGAVSP M in isoform 11.
VSP_047056
Alternative sequence11M → MNTGRDSQSPDSAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 2, isoform 4 and isoform 5.
VSP_034792
Alternative sequence11M → MNTGRDSQSPDSAWRSYNDG NQETLNGDATYSSLAAKGFR SVRPNLQDKRSPTQSQITVN GNSGGAVSPM in isoform 8.
VSP_045640
Alternative sequence11M → MSVTLTSVKRVQSSPNLLAA GRDSQSPDSAWRSYNDGNQE TLNGDATYSSLAAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 9 and isoform 12.
VSP_046219
Alternative sequence82 – 898GIPTAIRT → MKATTPLQ in isoform 6.
VSP_034793
Alternative sequence112 – 12615Missing in isoform 7 and isoform 9.
VSP_043666
Alternative sequence2281P → PTDRINPDDIDLENEPWYKF FSELEFGRPPPKKPLDYVQD HSSGVFNE in isoform 2.
VSP_034794
Alternative sequence2281P → PPPLPTTPTPVPREPGRKPL SSSRLGEVTGSPSPPPRSGA PTPSSRAPALSPTRPPKKPL DYVQDHSSGVFNE in isoform 3, isoform 4, isoform 5, isoform 10 and isoform 12.
VSP_034795
Alternative sequence2281P → PPPKKPLDYVQDHSSGVFNE in isoform 8.
VSP_045641
Alternative sequence229 – 2379ASLYQSSID → VSKPQAGRR in isoform 6.
VSP_034796
Alternative sequence238 – 1100863Missing in isoform 6.
VSP_034797
Alternative sequence308 – 834527Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 8, isoform 9, isoform 10 and isoform 12.
VSP_034798
Alternative sequence1050 – 110051YNYTP…YVKRL → GYTLT in isoform 5.
VSP_034799
Natural variant10481A → V.
Corresponds to variant rs725185 [ dbSNP | Ensembl ].
VAR_045624

Experimental info

Sequence conflict731P → L in AK225327. Ref.5
Sequence conflict2061R → Q in AK225327. Ref.5
Sequence conflict2311L → S in BAG51769. Ref.4
Sequence conflict5361L → P in BAG51769. Ref.4
Sequence conflict8911Y → N in BAG51769. Ref.4
Sequence conflict10341F → L in BAH11501. Ref.4
Isoform 2:
Sequence conflict131A → P in AAC05509. Ref.1
Isoform 5:
Sequence conflict131A → P in AAC05508. Ref.1
Isoform 10:
Sequence conflict4241K → E in AK225812. Ref.5

Secondary structure

......... 1100
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 22, 2008. Version 3.
Checksum: 7E98B196D4DB38E6

FASTA1,100124,108
        10         20         30         40         50         60 
MSYYQRPFSP SAYSLPASLN SSIVMQHGTS LDSTDTYPQH AQSLDGTTSS SIPLYRSSEE 

        70         80         90        100        110        120 
EKRVTVIKAP HYPGIGPVDE SGIPTAIRTT VDRPKDWYKT MFKQIHMVHK PDDDTDMYNT 

       130        140        150        160        170        180 
PYTYNAGLYN PPYSAQSHPA AKTQTYRPLS KSHSDNSPNA FKDASSPVPP PHVPPPVPPL 

       190        200        210        220        230        240 
RPRDRSSTEK HDWDPPDRKV DTRKFRSEPR SIFEYEPGKS SILQHERPAS LYQSSIDRSL 

       250        260        270        280        290        300 
ERPMSSASMA SDFRKRRKSE PAVGPPRGLG DQSASRTSPG RVDLPGSSTT LTKSFTSSSP 

       310        320        330        340        350        360 
SSPSRAKGGD DSKICPSLCS YSGLNGNPSS ELDYCSTYRQ HLDVPRDSPR AISFKNGWQM 

       370        380        390        400        410        420 
ARQNAEIWSS TEETVSPKIK SRSCDDLLND DCDSFPDPKV KSESMGSLLC EEDSKESCPM 

       430        440        450        460        470        480 
AWGSPYVPEV RSNGRSRIRH RSARNAPGFL KMYKKMHRIN RKDLMNSEVI CSVKSRILQY 

       490        500        510        520        530        540 
ESEQQHKDLL RAWSQCSTEE VPRDMVPTRI SEFEKLIQKS KSMPNLGDDM LSPVTLEPPQ 

       550        560        570        580        590        600 
NGLCPKRRFS IEYLLEEENQ SGPPARGRRG CQSNALVPIH IEVTSDEQPR AHVEFSDSDQ 

       610        620        630        640        650        660 
DGVVSDHSDY IHLEGSSFCS ESDFDHFSFT SSESFYGSSH HHHHHHHHHH RHLISSCKGR 

       670        680        690        700        710        720 
CPASYTRFTT MLKHERARHE NTEEPRRQEM DPGLSKLAFL VSPVPFRRKK NSAPKKQTEK 

       730        740        750        760        770        780 
AKCKASVFEA LDSALKDICD QIKAEKKRGS LPDNSILHRL ISELLPDVPE RNSSLRALRR 

       790        800        810        820        830        840 
SPLHQPLHPL PPDGAIHCPP YQNDCGRMPR SASFQDVDTA NSSCHHQDRG GALQDRESPR 

       850        860        870        880        890        900 
SYSSTLTDMG RSAPRERRGT PEKEKLPAKA VYDFKAQTSK ELSFKKGDTV YILRKIDQNW 

       910        920        930        940        950        960 
YEGEHHGRVG IFPISYVEKL TPPEKAQPAR PPPPAQPGEI GEAIAKYNFN ADTNVELSLR 

       970        980        990       1000       1010       1020 
KGDRVILLKR VDQNWYEGKI PGTNRQGIFP VSYVEVVKKN TKGAEDYPDP PIPHSYSSDR 

      1030       1040       1050       1060       1070       1080 
IHSLSSNKPQ RPVFTHENIQ GGGEPFQALY NYTPRNEDEL ELRESDVIDV MEKCDDGWFV 

      1090       1100 
GTSRRTKFFG TFPGNYVKRL 

« Hide

Isoform 2 (ArgBP2a) [UniParc].

Checksum: 92504C18534CD94B
Show »

FASTA66674,778
Isoform 3 [UniParc].

Checksum: 8CDEF6E34D5F972F
Show »

FASTA64571,899
Isoform 4 [UniParc].

Checksum: 1CF7D8E8E49233B8
Show »

FASTA69176,712
Isoform 5 (ArgBP2b) [UniParc].

Checksum: 455C7808CED30D41
Show »

FASTA64571,170
Isoform 6 (Sorbin) [UniParc].

Checksum: 95AE8B49881FCC12
Show »

FASTA15617,976
Isoform 7 [UniParc].

Checksum: 1D2245E4FC6037EB
Show »

FASTA1,004113,555
Isoform 8 [UniParc].

Checksum: D72A9CE26ADB7BAD
Show »

FASTA66173,868
Isoform 9 [UniParc].

Checksum: 19886F6C073CEB1E
Show »

FASTA64471,686
Isoform 10 [UniParc].

Checksum: EB10B42B47D6751B
Show »

FASTA82491,277
Isoform 11 [UniParc].

Checksum: 836875AFD6649C8B
Show »

FASTA1,200134,594
Isoform 12 [UniParc].

Checksum: C98B891C2124E1F7
Show »

FASTA73180,966

References

« Hide 'large scale' references
[1]"ArgBP2, a multiple Src homology 3 domain-containing, Arg/Abl-interacting protein, is phosphorylated in v-Abl-transformed cells and localized in stress fibers and cardiocyte Z-disks."
Wang B., Golemis E.A., Kruh G.D.
J. Biol. Chem. 272:17542-17550(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 5), NUCLEOTIDE SEQUENCE [MRNA] OF 1-1049 (ISOFORM 4), PHOSPHORYLATION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH ABL1 AND ABL2, FUNCTION.
Tissue: Brain.
[2]"Coding region of the sorbin gene in different species."
Wahbi K., Magaud J.-P., Pansu D., Descroix-Vagne M.
Peptides 22:2045-2053(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), AMIDATION AT ALA-153 (ISOFORM 6), TISSUE SPECIFICITY.
[3]"Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 7; 8 AND 11).
Tissue: Embryonic brain, Thalamus and Urinary bladder.
[5]Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 9 AND 10).
Tissue: Heart and Hepatoma.
[6]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Lymph.
[9]"Cbl-ArgBP2 complex mediates ubiquitination and degradation of c-Abl."
Soubeyran P., Barac A., Szymkiewicz I., Dikic I.
Biochem. J. 370:29-34(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH CBL, UBIQUITINATION BY CBL, FUNCTION.
[10]"Involvement of palladin and alpha-actinin in targeting of the Abl/Arg kinase adaptor ArgBP2 to the actin cytoskeleton."
Roenty M., Taivainen A., Moza M., Kruh G.D., Ehler E., Carpen O.
Exp. Cell Res. 310:88-98(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH PALLD AND ACTN, SUBCELLULAR LOCATION.
[11]"ArgBP2gamma interacts with Akt and p21-activated kinase-1 and promotes cell survival."
Yuan Z.-Q., Kim D., Kaneko S., Sussman M., Bokoch G.M., Kruh G.D., Nicosia S.V., Testa J.R., Cheng J.Q.
J. Biol. Chem. 280:21483-21490(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH AKT1 AND PAK1, UBIQUITINATION BY CBL, PHOSPHORYLATION.
[12]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157; THR-277; SER-301 AND SER-302, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-437 AND SER-439 (ISOFORM 10), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344 AND SER-346 (ISOFORM 12), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 AND SER-260 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304 AND SER-306 (ISOFORMS 4 AND 5), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[13]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157; SER-298; SER-299 AND SER-302, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-437 AND SER-439 (ISOFORM 10), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-28 (ISOFORM 11), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344 AND SER-346 (ISOFORM 12), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14 (ISOFORMS 12 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 AND SER-260 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304 AND SER-306 (ISOFORMS 4 AND 5), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF049884 mRNA. Translation: AAC05508.1.
AF049885 mRNA. Translation: AAC05509.1.
AB018320 mRNA. Translation: BAA34497.2. Different initiation.
AK056628 mRNA. Translation: BAG51769.1.
AK293400 mRNA. Translation: BAH11501.1.
AK296461 mRNA. Translation: BAH12362.1.
AK225327 mRNA. No translation available.
AK225812 mRNA. No translation available.
AC093797 Genomic DNA. No translation available.
AC096659 Genomic DNA. No translation available.
AC104805 Genomic DNA. No translation available.
AC108472 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04630.1.
CH471056 Genomic DNA. Translation: EAX04631.1.
CH471056 Genomic DNA. Translation: EAX04632.1.
CH471056 Genomic DNA. Translation: EAX04635.1.
CH471056 Genomic DNA. Translation: EAX04636.1.
BC011883 mRNA. Translation: AAH11883.1.
CCDSCCDS3845.1. [O94875-1]
CCDS43289.2. [O94875-2]
CCDS47173.1. [O94875-9]
CCDS47174.1. [O94875-12]
CCDS47175.1. [O94875-10]
CCDS47176.1. [O94875-7]
CCDS54825.1. [O94875-8]
CCDS59482.1. [O94875-11]
RefSeqNP_001139142.1. NM_001145670.1. [O94875-9]
NP_001139143.1. NM_001145671.2. [O94875-12]
NP_001139144.1. NM_001145672.1. [O94875-8]
NP_001139145.1. NM_001145673.1. [O94875-10]
NP_001139146.1. NM_001145674.1. [O94875-7]
NP_001257700.1. NM_001270771.1. [O94875-11]
NP_003594.3. NM_003603.6. [O94875-2]
NP_066547.1. NM_021069.4. [O94875-1]
XP_005263369.1. XM_005263312.1. [O94875-4]
XP_006714453.1. XM_006714390.1. [O94875-8]
UniGeneHs.619806.
Hs.655143.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
4IGZX-ray1.33A866-921[»]
ProteinModelPortalO94875.
SMRO94875. Positions 855-1100.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114047. 28 interactions.
DIPDIP-31634N.
IntActO94875. 17 interactions.
MINTMINT-196404.
STRING9606.ENSP00000284776.

PTM databases

PhosphoSiteO94875.

Proteomic databases

MaxQBO94875.
PaxDbO94875.
PRIDEO94875.

Protocols and materials databases

DNASU8470.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000284776; ENSP00000284776; ENSG00000154556. [O94875-1]
ENST00000319471; ENSP00000322182; ENSG00000154556. [O94875-12]
ENST00000355634; ENSP00000347852; ENSG00000154556. [O94875-11]
ENST00000393528; ENSP00000377162; ENSG00000154556. [O94875-2]
ENST00000418609; ENSP00000397482; ENSG00000154556. [O94875-7]
ENST00000431808; ENSP00000411764; ENSG00000154556. [O94875-1]
ENST00000437304; ENSP00000396008; ENSG00000154556. [O94875-10]
ENST00000448662; ENSP00000409158; ENSG00000154556. [O94875-8]
ENST00000449407; ENSP00000397262; ENSG00000154556. [O94875-9]
GeneID8470.
KEGGhsa:8470.
UCSCuc003iya.3. human.
uc003iyb.3. human. [O94875-3]
uc003iyl.3. human. [O94875-1]
uc011ckv.2. human. [O94875-7]

Organism-specific databases

CTD8470.
GeneCardsGC04M186506.
HGNCHGNC:24098. SORBS2.
HPAHPA036754.
HPA036755.
neXtProtNX_O94875.
PharmGKBPA142670890.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG256936.
HOGENOMHOG000294090.
HOVERGENHBG108509.
InParanoidO94875.
OMAPREPGRK.
OrthoDBEOG7FFMQT.
PhylomeDBO94875.
TreeFamTF320680.

Enzyme and pathway databases

SignaLinkO94875.

Gene expression databases

ArrayExpressO94875.
BgeeO94875.
CleanExHS_SORBS2.
GenevestigatorO94875.

Family and domain databases

InterProIPR028516. ArgBP2.
IPR001452. SH3_domain.
IPR003127. Sorb.
IPR007087. Znf_C2H2.
[Graphical view]
PANTHERPTHR10661:SF122. PTHR10661:SF122. 1 hit.
PfamPF00018. SH3_1. 2 hits.
PF14604. SH3_9. 1 hit.
PF02208. Sorb. 1 hit.
[Graphical view]
PRINTSPR00452. SH3DOMAIN.
SMARTSM00326. SH3. 3 hits.
SM00459. Sorb. 1 hit.
[Graphical view]
SUPFAMSSF50044. SSF50044. 3 hits.
PROSITEPS50002. SH3. 3 hits.
PS50831. SOHO. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSORBS2. human.
GeneWikiSORBS2.
GenomeRNAi8470.
NextBio31696.
PROO94875.

Entry information

Entry nameSRBS2_HUMAN
AccessionPrimary (citable) accession number: O94875
Secondary accession number(s): A6NEK9 expand/collapse secondary AC list , B3KPQ7, B7Z1G5, B7Z3X6, C9JKV9, D3DP62, D3DP63, E9PAS5, E9PAW4, G3XAI0, H7BXR4, J3KNZ5, O60592, O60593, Q96EX0
Entry history
Integrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: July 22, 2008
Last modified: July 9, 2014
This is version 119 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM