Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sorbin and SH3 domain-containing protein 2

Gene

SORBS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1 or with AKT1 and PAK1, thus mediating AKT1-mediated activation of PAK1. Isoform 6 increases water and sodium absorption in the intestine and gall-bladder.2 Publications

GO - Molecular functioni

  • cytoskeletal adaptor activity Source: ProtInc
  • metal ion binding Source: InterPro
  • poly(A) RNA binding Source: UniProtKB
  • structural constituent of cytoskeleton Source: ProtInc
  • structural constituent of muscle Source: ProtInc

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

SignaLinkiO94875.

Names & Taxonomyi

Protein namesi
Recommended name:
Sorbin and SH3 domain-containing protein 2
Alternative name(s):
Arg/Abl-interacting protein 2
Short name:
ArgBP2
Sorbin
Gene namesi
Name:SORBS2
Synonyms:ARGBP2, KIAA0777
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:24098. SORBS2.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: ProtInc
  • nucleus Source: UniProtKB
  • perinuclear region of cytoplasm Source: UniProtKB-SubCell
  • plasma membrane Source: Ensembl
  • Z disc Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670890.

Polymorphism and mutation databases

BioMutaiSORBS2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11001100Sorbin and SH3 domain-containing protein 2PRO_0000344477Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei154 – 1541Phosphoserine1 Publication
Modified residuei157 – 1571Phosphoserine3 Publications
Modified residuei239 – 2391Phosphoserine1 Publication
Modified residuei259 – 2591Phosphoserine1 Publication
Modified residuei277 – 2771Phosphothreonine1 Publication
Modified residuei287 – 2871Phosphoserine1 Publication
Modified residuei292 – 2921Phosphothreonine1 Publication
Modified residuei298 – 2981Phosphoserine1 Publication
Modified residuei299 – 2991Phosphoserine1 Publication
Modified residuei301 – 3011Phosphoserine1 Publication
Modified residuei302 – 3021Phosphoserine3 Publications
Modified residuei304 – 3041Phosphoserine1 Publication
Modified residuei750 – 7501PhosphoserineBy similarity
Modified residuei843 – 8431Phosphoserine1 Publication
Modified residuei1017 – 10171PhosphoserineBy similarity
Modified residuei1023 – 10231Phosphoserine1 Publication

Post-translational modificationi

Ubiquitinated by CBL.2 Publications

Keywords - PTMi

Amidation, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiO94875.
PaxDbiO94875.
PRIDEiO94875.

PTM databases

PhosphoSiteiO94875.

Expressioni

Tissue specificityi

Abundantly expressed in heart. In cardiac muscle cells, located in the Z-disks of sarcomere. Also found, but to a lower extent, in small and large intestine, pancreas, thymus, colon, spleen, prostate, testis, brain, ovary and epithelial cells.2 Publications

Gene expression databases

BgeeiO94875.
CleanExiHS_SORBS2.
ExpressionAtlasiO94875. baseline and differential.
GenevestigatoriO94875.

Organism-specific databases

HPAiHPA036754.
HPA036755.

Interactioni

Subunit structurei

Interacts with ABL, CBL, DNM1, DNM2, FLOT1, MLLT4/afadin, PTK2B/PYK2, SAPAP, SPTAN1, SYNJ1, SYNJ2, VCL/vinculin, and WASF (By similarity). Interacts with ABL1/c-Abl, ABL2/v-Abl/Arg, ACTN, AKT1, CBL, PALLD and PAK1.By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Q9WMX22EBI-311323,EBI-6863748From a different organism.
ATPAF2Q8N5M13EBI-311323,EBI-1166928
EFSO432813EBI-311323,EBI-718488
HEL2V9HW983EBI-311323,EBI-10190883
NCK2O436393EBI-311323,EBI-713635
PAK2Q131772EBI-311323,EBI-1045887
PALLDQ8WX932EBI-311323,EBI-2803991
SH2D4AQ9H788-23EBI-311323,EBI-10308083
VPS37CA5D8V63EBI-311323,EBI-2559305
WASP427683EBI-311323,EBI-346375
YWHAZP631042EBI-311323,EBI-347088

Protein-protein interaction databases

BioGridi114047. 35 interactions.
DIPiDIP-31634N.
IntActiO94875. 25 interactions.
MINTiMINT-196404.
STRINGi9606.ENSP00000284776.

Structurei

Secondary structure

1
1100
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi866 – 8727Combined sources
Beta strandi889 – 90517Combined sources
Beta strandi908 – 9136Combined sources
Helixi914 – 9163Combined sources
Beta strandi917 – 9193Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4IGZX-ray1.33A866-921[»]
ProteinModelPortaliO94875.
SMRiO94875. Positions 864-999, 1046-1100.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini66 – 12762SoHoPROSITE-ProRule annotationAdd
BLAST
Domaini863 – 92260SH3 1PROSITE-ProRule annotationAdd
BLAST
Domaini938 – 99962SH3 2PROSITE-ProRule annotationAdd
BLAST
Domaini1041 – 110060SH3 3PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi167 – 18216Pro-richAdd
BLAST
Compositional biasi640 – 65213His-richAdd
BLAST
Compositional biasi931 – 9344Poly-Pro

Sequence similaritiesi

Contains 3 SH3 domains.PROSITE-ProRule annotation
Contains 1 SoHo domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiNOG256936.
GeneTreeiENSGT00760000119190.
HOGENOMiHOG000294090.
HOVERGENiHBG108509.
InParanoidiO94875.
OMAiPREPGRK.
OrthoDBiEOG7FFMQT.
PhylomeDBiO94875.
TreeFamiTF320680.

Family and domain databases

InterProiIPR028516. ArgBP2.
IPR001452. SH3_domain.
IPR003127. Sorb.
IPR007087. Znf_C2H2.
[Graphical view]
PANTHERiPTHR10661:SF122. PTHR10661:SF122. 1 hit.
PfamiPF00018. SH3_1. 2 hits.
PF14604. SH3_9. 1 hit.
PF02208. Sorb. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00326. SH3. 3 hits.
SM00459. Sorb. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 3 hits.
PROSITEiPS50002. SH3. 3 hits.
PS50831. SOHO. 1 hit.
[Graphical view]

Sequences (12)i

Sequence statusi: Complete.

This entry describes 12 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O94875-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSYYQRPFSP SAYSLPASLN SSIVMQHGTS LDSTDTYPQH AQSLDGTTSS
60 70 80 90 100
SIPLYRSSEE EKRVTVIKAP HYPGIGPVDE SGIPTAIRTT VDRPKDWYKT
110 120 130 140 150
MFKQIHMVHK PDDDTDMYNT PYTYNAGLYN PPYSAQSHPA AKTQTYRPLS
160 170 180 190 200
KSHSDNSPNA FKDASSPVPP PHVPPPVPPL RPRDRSSTEK HDWDPPDRKV
210 220 230 240 250
DTRKFRSEPR SIFEYEPGKS SILQHERPAS LYQSSIDRSL ERPMSSASMA
260 270 280 290 300
SDFRKRRKSE PAVGPPRGLG DQSASRTSPG RVDLPGSSTT LTKSFTSSSP
310 320 330 340 350
SSPSRAKGGD DSKICPSLCS YSGLNGNPSS ELDYCSTYRQ HLDVPRDSPR
360 370 380 390 400
AISFKNGWQM ARQNAEIWSS TEETVSPKIK SRSCDDLLND DCDSFPDPKV
410 420 430 440 450
KSESMGSLLC EEDSKESCPM AWGSPYVPEV RSNGRSRIRH RSARNAPGFL
460 470 480 490 500
KMYKKMHRIN RKDLMNSEVI CSVKSRILQY ESEQQHKDLL RAWSQCSTEE
510 520 530 540 550
VPRDMVPTRI SEFEKLIQKS KSMPNLGDDM LSPVTLEPPQ NGLCPKRRFS
560 570 580 590 600
IEYLLEEENQ SGPPARGRRG CQSNALVPIH IEVTSDEQPR AHVEFSDSDQ
610 620 630 640 650
DGVVSDHSDY IHLEGSSFCS ESDFDHFSFT SSESFYGSSH HHHHHHHHHH
660 670 680 690 700
RHLISSCKGR CPASYTRFTT MLKHERARHE NTEEPRRQEM DPGLSKLAFL
710 720 730 740 750
VSPVPFRRKK NSAPKKQTEK AKCKASVFEA LDSALKDICD QIKAEKKRGS
760 770 780 790 800
LPDNSILHRL ISELLPDVPE RNSSLRALRR SPLHQPLHPL PPDGAIHCPP
810 820 830 840 850
YQNDCGRMPR SASFQDVDTA NSSCHHQDRG GALQDRESPR SYSSTLTDMG
860 870 880 890 900
RSAPRERRGT PEKEKLPAKA VYDFKAQTSK ELSFKKGDTV YILRKIDQNW
910 920 930 940 950
YEGEHHGRVG IFPISYVEKL TPPEKAQPAR PPPPAQPGEI GEAIAKYNFN
960 970 980 990 1000
ADTNVELSLR KGDRVILLKR VDQNWYEGKI PGTNRQGIFP VSYVEVVKKN
1010 1020 1030 1040 1050
TKGAEDYPDP PIPHSYSSDR IHSLSSNKPQ RPVFTHENIQ GGGEPFQALY
1060 1070 1080 1090 1100
NYTPRNEDEL ELRESDVIDV MEKCDDGWFV GTSRRTKFFG TFPGNYVKRL
Length:1,100
Mass (Da):124,108
Last modified:July 22, 2008 - v3
Checksum:i7E98B196D4DB38E6
GO
Isoform 2 (identifier: O94875-2) [UniParc]FASTAAdd to basket

Also known as: ArgBP2a

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PTDRINPDDIDLENEPWYKFFSELEFGRPPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Note: Contains a phosphoserine at position 316.Curated1 Publication

Show »
Length:666
Mass (Da):74,778
Checksum:i92504C18534CD94B
GO
Isoform 3 (identifier: O94875-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Note: Contains a phosphoserine at position 258. Contains a phosphoserine at position 260. Contains a phosphothreonine at position 280. Contains a phosphothreonine at position 234. Contains a phosphothreonine at position 236. Contains a phosphoserine at position 295.3 Publications

Show »
Length:645
Mass (Da):71,899
Checksum:i8CDEF6E34D5F972F
GO
Isoform 4 (identifier: O94875-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Note: Contains a phosphoserine at position 304. Contains a phosphoserine at position 306. Contains a phosphothreonine at position 326. Contains a phosphothreonine at position 280. Contains a phosphothreonine at position 282. Contains a phosphoserine at position 341.3 Publications

Show »
Length:691
Mass (Da):76,712
Checksum:i1CF7D8E8E49233B8
GO
Isoform 5 (identifier: O94875-5) [UniParc]FASTAAdd to basket

Also known as: ArgBP2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.
     1050-1100: YNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL → GYTLT

Note: Contains a phosphoserine at position 304. Contains a phosphoserine at position 306. Contains a phosphothreonine at position 326. Contains a phosphothreonine at position 280. Contains a phosphothreonine at position 282. Contains a phosphoserine at position 341.Curated3 Publications

Show »
Length:645
Mass (Da):71,170
Checksum:i455C7808CED30D41
GO
Isoform 6 (identifier: O94875-6) [UniParc]FASTAAdd to basket

Also known as: Sorbin

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     82-89: GIPTAIRT → MKATTPLQ
     229-237: ASLYQSSID → VSKPQAGRR
     238-1100: Missing.

Note: Contains a alanine amide at position 153.

Show »
Length:156
Mass (Da):17,976
Checksum:i95AE8B49881FCC12
GO
Isoform 7 (identifier: O94875-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MSYYQRPFSP...ESGIPTAIRT → MKATTPLQ
     112-126: Missing.

Note: No experimental confirmation available.

Show »
Length:1,004
Mass (Da):113,555
Checksum:i1D2245E4FC6037EB
GO
Isoform 8 (identifier: O94875-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAWRSYNDGNQETLNGDATYSSLAAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Note: No experimental confirmation available. Contains a phosphoserine at position 311.1 Publication

Show »
Length:661
Mass (Da):73,868
Checksum:iD72A9CE26ADB7BAD
GO
Isoform 9 (identifier: O94875-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSVTLTSVKR...GNSGGAVSPM
     112-126: Missing.
     308-834: Missing.

Note: No experimental confirmation available. Contains a phosphoserine at position 14. Contains a phosphoserine at position 13.2 Publications

Show »
Length:644
Mass (Da):71,686
Checksum:i19886F6C073CEB1E
GO
Isoform 10 (identifier: O94875-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYSNEDSRQT...GNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Note: No experimental confirmation available.Curated3 Publications

Contains a phosphoserine at position 437. Contains a phosphoserine at position 439. Contains a phosphothreonine at position 459. Contains a phosphothreonine at position 413. Contains a phosphothreonine at position 415. Contains a phosphoserine at position 474.Curated3 Publications

Show »
Length:824
Mass (Da):91,277
Checksum:iEB10B42B47D6751B
GO
Isoform 11 (identifier: O94875-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTDSGGCAR...GNSGGAVSPM

Note: Contains a phosphoserine at position 28. Contains a phosphoserine at position 27.2 Publications

Show »
Length:1,200
Mass (Da):134,594
Checksum:i836875AFD6649C8B
GO
Isoform 12 (identifier: O94875-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSVTLTSVKR...GNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Note: Contains a phosphoserine at position 344. Contains a phosphoserine at position 346. Contains a phosphoserine at position 14. Contains a phosphothreonine at position 366. Contains a phosphothreonine at position 320. Contains a phosphoserine at position 13. Contains a phosphothreonine at position 322. Contains a phosphoserine at position 381.3 Publications

Show »
Length:731
Mass (Da):80,966
Checksum:iC98B891C2124E1F7
GO

Sequence cautioni

The sequence BAA34497.2 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti73 – 731P → L in AK225327 (Ref. 5) Curated
Sequence conflicti206 – 2061R → Q in AK225327 (Ref. 5) Curated
Sequence conflicti231 – 2311L → S in BAG51769 (PubMed:14702039).Curated
Sequence conflicti536 – 5361L → P in BAG51769 (PubMed:14702039).Curated
Sequence conflicti891 – 8911Y → N in BAG51769 (PubMed:14702039).Curated
Sequence conflicti1034 – 10341F → L in BAH11501 (PubMed:14702039).Curated
Isoform 2 (identifier: O94875-2)
Sequence conflicti13 – 131A → P in AAC05509 (PubMed:9211900).Curated1 Publication
Isoform 5 (identifier: O94875-5)
Sequence conflicti13 – 131A → P in AAC05508 (PubMed:9211900).Curated3 Publications
Isoform 10 (identifier: O94875-10)
Sequence conflicti424 – 4241K → E in AK225812 (Ref. 5) Curated3 Publications

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1048 – 10481A → V.
Corresponds to variant rs725185 [ dbSNP | Ensembl ].
VAR_045624

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8989MSYYQ…TAIRT → MKATTPLQ in isoform 7. 1 PublicationVSP_043665Add
BLAST
Alternative sequencei1 – 8181Missing in isoform 6. 1 PublicationVSP_034791Add
BLAST
Alternative sequencei1 – 11M → MYSNEDSRQTIVYSEESNTT MSYTQKITNPLPAASSTDPA PFANINTPVLQEDYRQDSQT RRISTLKLTHNQDLGSSSPI STPQFSKSVEVPSFLKRPRS LTPNPVPETHTASLSIQIAP LSGQDLESHKQLPELSPETA KIPLQQERQKSAVAAASQSS DCRVSQITVNGNSGGAVSPM in isoform 10. 1 PublicationVSP_046220
Alternative sequencei1 – 11M → MNTDSGGCARKRAAMSVTLT SVKRVQSSPNLLAAGRDSQS PDSAWRSYNDGNQETLNGDA TYSSLAAKGFRSVRPNLQDK RSPTQSQITVNGNSGGAVSP M in isoform 11. 1 PublicationVSP_047056
Alternative sequencei1 – 11M → MNTGRDSQSPDSAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 2, isoform 4 and isoform 5. 1 PublicationVSP_034792
Alternative sequencei1 – 11M → MNTGRDSQSPDSAWRSYNDG NQETLNGDATYSSLAAKGFR SVRPNLQDKRSPTQSQITVN GNSGGAVSPM in isoform 8. 1 PublicationVSP_045640
Alternative sequencei1 – 11M → MSVTLTSVKRVQSSPNLLAA GRDSQSPDSAWRSYNDGNQE TLNGDATYSSLAAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 9 and isoform 12. 1 PublicationVSP_046219
Alternative sequencei82 – 898GIPTAIRT → MKATTPLQ in isoform 6. 1 PublicationVSP_034793
Alternative sequencei112 – 12615Missing in isoform 7 and isoform 9. 2 PublicationsVSP_043666Add
BLAST
Alternative sequencei228 – 2281P → PTDRINPDDIDLENEPWYKF FSELEFGRPPPKKPLDYVQD HSSGVFNE in isoform 2. 1 PublicationVSP_034794
Alternative sequencei228 – 2281P → PPPLPTTPTPVPREPGRKPL SSSRLGEVTGSPSPPPRSGA PTPSSRAPALSPTRPPKKPL DYVQDHSSGVFNE in isoform 3, isoform 4, isoform 5, isoform 10 and isoform 12. 3 PublicationsVSP_034795
Alternative sequencei228 – 2281P → PPPKKPLDYVQDHSSGVFNE in isoform 8. 1 PublicationVSP_045641
Alternative sequencei229 – 2379ASLYQSSID → VSKPQAGRR in isoform 6. 1 PublicationVSP_034796
Alternative sequencei238 – 1100863Missing in isoform 6. 1 PublicationVSP_034797Add
BLAST
Alternative sequencei308 – 834527Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 8, isoform 9, isoform 10 and isoform 12. 4 PublicationsVSP_034798Add
BLAST
Alternative sequencei1050 – 110051YNYTP…YVKRL → GYTLT in isoform 5. 1 PublicationVSP_034799Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF049884 mRNA. Translation: AAC05508.1.
AF049885 mRNA. Translation: AAC05509.1.
AB018320 mRNA. Translation: BAA34497.2. Different initiation.
AK056628 mRNA. Translation: BAG51769.1.
AK293400 mRNA. Translation: BAH11501.1.
AK296461 mRNA. Translation: BAH12362.1.
AK225327 mRNA. No translation available.
AK225812 mRNA. No translation available.
AC093797 Genomic DNA. No translation available.
AC096659 Genomic DNA. No translation available.
AC104805 Genomic DNA. No translation available.
AC108472 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04630.1.
CH471056 Genomic DNA. Translation: EAX04631.1.
CH471056 Genomic DNA. Translation: EAX04632.1.
CH471056 Genomic DNA. Translation: EAX04635.1.
CH471056 Genomic DNA. Translation: EAX04636.1.
BC011883 mRNA. Translation: AAH11883.1.
CCDSiCCDS3845.1. [O94875-1]
CCDS43289.2. [O94875-2]
CCDS47173.1. [O94875-9]
CCDS47174.1. [O94875-12]
CCDS47175.1. [O94875-10]
CCDS47176.1. [O94875-7]
CCDS54825.1. [O94875-8]
CCDS59482.1. [O94875-11]
RefSeqiNP_001139142.1. NM_001145670.1. [O94875-9]
NP_001139143.1. NM_001145671.2. [O94875-12]
NP_001139144.1. NM_001145672.1. [O94875-8]
NP_001139145.1. NM_001145673.1. [O94875-10]
NP_001139146.1. NM_001145674.1. [O94875-7]
NP_001257700.1. NM_001270771.1. [O94875-11]
NP_003594.3. NM_003603.6. [O94875-2]
NP_066547.1. NM_021069.4. [O94875-1]
XP_005263369.1. XM_005263312.1. [O94875-4]
XP_006714453.1. XM_006714390.1. [O94875-8]
UniGeneiHs.619806.
Hs.655143.

Genome annotation databases

EnsembliENST00000284776; ENSP00000284776; ENSG00000154556. [O94875-1]
ENST00000319471; ENSP00000322182; ENSG00000154556. [O94875-12]
ENST00000355634; ENSP00000347852; ENSG00000154556. [O94875-11]
ENST00000393528; ENSP00000377162; ENSG00000154556. [O94875-2]
ENST00000418609; ENSP00000397482; ENSG00000154556. [O94875-7]
ENST00000437304; ENSP00000396008; ENSG00000154556. [O94875-10]
ENST00000448662; ENSP00000409158; ENSG00000154556. [O94875-8]
ENST00000449407; ENSP00000397262; ENSG00000154556. [O94875-9]
GeneIDi8470.
KEGGihsa:8470.
UCSCiuc003iya.3. human.
uc003iyb.3. human. [O94875-3]
uc003iyl.3. human. [O94875-1]
uc011ckv.2. human. [O94875-7]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF049884 mRNA. Translation: AAC05508.1.
AF049885 mRNA. Translation: AAC05509.1.
AB018320 mRNA. Translation: BAA34497.2. Different initiation.
AK056628 mRNA. Translation: BAG51769.1.
AK293400 mRNA. Translation: BAH11501.1.
AK296461 mRNA. Translation: BAH12362.1.
AK225327 mRNA. No translation available.
AK225812 mRNA. No translation available.
AC093797 Genomic DNA. No translation available.
AC096659 Genomic DNA. No translation available.
AC104805 Genomic DNA. No translation available.
AC108472 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04630.1.
CH471056 Genomic DNA. Translation: EAX04631.1.
CH471056 Genomic DNA. Translation: EAX04632.1.
CH471056 Genomic DNA. Translation: EAX04635.1.
CH471056 Genomic DNA. Translation: EAX04636.1.
BC011883 mRNA. Translation: AAH11883.1.
CCDSiCCDS3845.1. [O94875-1]
CCDS43289.2. [O94875-2]
CCDS47173.1. [O94875-9]
CCDS47174.1. [O94875-12]
CCDS47175.1. [O94875-10]
CCDS47176.1. [O94875-7]
CCDS54825.1. [O94875-8]
CCDS59482.1. [O94875-11]
RefSeqiNP_001139142.1. NM_001145670.1. [O94875-9]
NP_001139143.1. NM_001145671.2. [O94875-12]
NP_001139144.1. NM_001145672.1. [O94875-8]
NP_001139145.1. NM_001145673.1. [O94875-10]
NP_001139146.1. NM_001145674.1. [O94875-7]
NP_001257700.1. NM_001270771.1. [O94875-11]
NP_003594.3. NM_003603.6. [O94875-2]
NP_066547.1. NM_021069.4. [O94875-1]
XP_005263369.1. XM_005263312.1. [O94875-4]
XP_006714453.1. XM_006714390.1. [O94875-8]
UniGeneiHs.619806.
Hs.655143.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4IGZX-ray1.33A866-921[»]
ProteinModelPortaliO94875.
SMRiO94875. Positions 864-999, 1046-1100.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114047. 35 interactions.
DIPiDIP-31634N.
IntActiO94875. 25 interactions.
MINTiMINT-196404.
STRINGi9606.ENSP00000284776.

PTM databases

PhosphoSiteiO94875.

Polymorphism and mutation databases

BioMutaiSORBS2.

Proteomic databases

MaxQBiO94875.
PaxDbiO94875.
PRIDEiO94875.

Protocols and materials databases

DNASUi8470.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000284776; ENSP00000284776; ENSG00000154556. [O94875-1]
ENST00000319471; ENSP00000322182; ENSG00000154556. [O94875-12]
ENST00000355634; ENSP00000347852; ENSG00000154556. [O94875-11]
ENST00000393528; ENSP00000377162; ENSG00000154556. [O94875-2]
ENST00000418609; ENSP00000397482; ENSG00000154556. [O94875-7]
ENST00000437304; ENSP00000396008; ENSG00000154556. [O94875-10]
ENST00000448662; ENSP00000409158; ENSG00000154556. [O94875-8]
ENST00000449407; ENSP00000397262; ENSG00000154556. [O94875-9]
GeneIDi8470.
KEGGihsa:8470.
UCSCiuc003iya.3. human.
uc003iyb.3. human. [O94875-3]
uc003iyl.3. human. [O94875-1]
uc011ckv.2. human. [O94875-7]

Organism-specific databases

CTDi8470.
GeneCardsiGC04M186506.
HGNCiHGNC:24098. SORBS2.
HPAiHPA036754.
HPA036755.
neXtProtiNX_O94875.
PharmGKBiPA142670890.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG256936.
GeneTreeiENSGT00760000119190.
HOGENOMiHOG000294090.
HOVERGENiHBG108509.
InParanoidiO94875.
OMAiPREPGRK.
OrthoDBiEOG7FFMQT.
PhylomeDBiO94875.
TreeFamiTF320680.

Enzyme and pathway databases

SignaLinkiO94875.

Miscellaneous databases

ChiTaRSiSORBS2. human.
GeneWikiiSORBS2.
GenomeRNAii8470.
NextBioi31696.
PROiO94875.

Gene expression databases

BgeeiO94875.
CleanExiHS_SORBS2.
ExpressionAtlasiO94875. baseline and differential.
GenevestigatoriO94875.

Family and domain databases

InterProiIPR028516. ArgBP2.
IPR001452. SH3_domain.
IPR003127. Sorb.
IPR007087. Znf_C2H2.
[Graphical view]
PANTHERiPTHR10661:SF122. PTHR10661:SF122. 1 hit.
PfamiPF00018. SH3_1. 2 hits.
PF14604. SH3_9. 1 hit.
PF02208. Sorb. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00326. SH3. 3 hits.
SM00459. Sorb. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 3 hits.
PROSITEiPS50002. SH3. 3 hits.
PS50831. SOHO. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "ArgBP2, a multiple Src homology 3 domain-containing, Arg/Abl-interacting protein, is phosphorylated in v-Abl-transformed cells and localized in stress fibers and cardiocyte Z-disks."
    Wang B., Golemis E.A., Kruh G.D.
    J. Biol. Chem. 272:17542-17550(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 5), NUCLEOTIDE SEQUENCE [MRNA] OF 1-1049 (ISOFORM 4), PHOSPHORYLATION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH ABL1 AND ABL2, FUNCTION.
    Tissue: Brain.
  2. "Coding region of the sorbin gene in different species."
    Wahbi K., Magaud J.-P., Pansu D., Descroix-Vagne M.
    Peptides 22:2045-2053(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), AMIDATION AT ALA-153 (ISOFORM 6), TISSUE SPECIFICITY.
  3. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 7; 8 AND 11).
    Tissue: Embryonic brain, Thalamus and Urinary bladder.
  5. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 9 AND 10).
    Tissue: Heart and Hepatoma.
  6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Lymph.
  9. "Cbl-ArgBP2 complex mediates ubiquitination and degradation of c-Abl."
    Soubeyran P., Barac A., Szymkiewicz I., Dikic I.
    Biochem. J. 370:29-34(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CBL, UBIQUITINATION BY CBL, FUNCTION.
  10. "Involvement of palladin and alpha-actinin in targeting of the Abl/Arg kinase adaptor ArgBP2 to the actin cytoskeleton."
    Roenty M., Taivainen A., Moza M., Kruh G.D., Ehler E., Carpen O.
    Exp. Cell Res. 310:88-98(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PALLD AND ACTN, SUBCELLULAR LOCATION.
  11. "ArgBP2gamma interacts with Akt and p21-activated kinase-1 and promotes cell survival."
    Yuan Z.-Q., Kim D., Kaneko S., Sussman M., Bokoch G.M., Kruh G.D., Nicosia S.V., Testa J.R., Cheng J.Q.
    J. Biol. Chem. 280:21483-21490(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH AKT1 AND PAK1, UBIQUITINATION BY CBL, PHOSPHORYLATION.
  12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157; THR-277; SER-301 AND SER-302, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-437 AND SER-439 (ISOFORM 10), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344 AND SER-346 (ISOFORM 12), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 AND SER-260 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304 AND SER-306 (ISOFORMS 4 AND 5), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157; SER-298; SER-299 AND SER-302, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-437 AND SER-439 (ISOFORM 10), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-28 (ISOFORM 11), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344 AND SER-346 (ISOFORM 12), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14 (ISOFORMS 12 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258 AND SER-260 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304 AND SER-306 (ISOFORMS 4 AND 5), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-154; SER-157; SER-239; SER-259; SER-287; THR-292; SER-302; SER-304; SER-843 AND SER-1023, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-413; THR-415; SER-439; THR-459 AND SER-474 (ISOFORM 10), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-27 AND SER-28 (ISOFORM 11), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-320; THR-322; SER-346; THR-366 AND SER-381 (ISOFORM 12), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-13 AND SER-14 (ISOFORMS 12 AND 9), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-316 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-234; THR-236; SER-260 AND SER-295 (ISOFORM 3), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-280 (ISOFORMS 3; 4 AND 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-282; SER-306; THR-326 AND SER-341 (ISOFORMS 4 AND 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-311 (ISOFORM 8), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiSRBS2_HUMAN
AccessioniPrimary (citable) accession number: O94875
Secondary accession number(s): A6NEK9
, B3KPQ7, B7Z1G5, B7Z3X6, C9JKV9, D3DP62, D3DP63, E9PAS5, E9PAW4, G3XAI0, H7BXR4, J3KNZ5, O60592, O60593, Q96EX0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: July 22, 2008
Last modified: May 27, 2015
This is version 129 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.