O94827 (PKHG5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 99.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pleckstrin homology domain-containing family G member 5 Short name=PH domain-containing family G member 5 Alternative name(s): Guanine nucleotide exchange factor 720 Short name=GEF720 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1062 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Activates the NF-kappa-B signaling pathway and RHOA. Appears to be involved in the control of neuronal cell differentiation. Ref.6 Ref.8 |
| Subunit structure | Interacts with GIPC1/synectin and RHOA By similarity. |
| Subcellular location | Cytoplasm. Cytoplasm › perinuclear region. Note: Predominantly cytoplasmic, however when cells are stimulated found in perinuclear regions By similarity. |
| Tissue specificity | Predominantly expressed in the peripheral nervous system and brain. Highest expression is observed in heart, lung, kidney, testis and moderate expression is present in spleen, pancreas, skeletal muscle, ovary and liver. Weakly expressed in glioblastoma (GBM) cell lines. Ref.1 Ref.8 Ref.9 |
| Involvement in disease | Distal spinal muscular atrophy, autosomal recessive, 4 (DSMA4) [MIM:611067]: A neuromuscular disorder. Distal spinal muscular atrophy, also known as distal hereditary motor neuronopathy, represents a heterogeneous group of neuromuscular disorders caused by selective degeneration of motor neurons in the anterior horn of the spinal cord, without sensory deficit in the posterior horn. The overall clinical picture consists of a classical distal muscular atrophy syndrome in the legs without clinical sensory loss. The disease starts with weakness and wasting of distal muscles of the anterior tibial and peroneal compartments of the legs. Later on, weakness and atrophy may expand to the proximal muscles of the lower limbs and/or to the distal upper limbs. DSMA4 is characterized by childhood onset, generalized muscle weakness and atrophy with denervation and normal sensation. Bulbar symptoms and pyramidal signs are absent. |
| Sequence similarities | Contains 1 DH (DBL-homology) domain. Contains 1 PH domain. |
| Sequence caution | The sequence BAA34440.2 differs from that shown. Reason: Erroneous initiation. The sequence BAC77354.1 differs from that shown. Reason: Aberrant splicing. The sequence BAC85124.1 differs from that shown. Reason: Probable cloning artifact. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94827-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94827-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNSVLTKHGSPPRSWLSLCSGT | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O94827-3) The sequence of this isoform differs from the canonical sequence as follows: 1-19: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O94827-4) The sequence of this isoform differs from the canonical sequence as follows: 1-56: Missing. 969-986: GIRTQGSPQEAGPSWDCR → AQEADPGPALPNQDHPAA 987-1062: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O94827-5) The sequence of this isoform differs from the canonical sequence as follows: 1-56: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: O94827-6) The sequence of this isoform differs from the canonical sequence as follows: 1-2: MD → MSLGERGSPQTFGGSSVSKGSDAGH | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: O94827-7) The sequence of this isoform differs from the canonical sequence as follows: 1-27: MDDQSPAEKKGLRCQNPACMDKGRAAK → MGTGPGVSGRLAASRPGPGLPLRDSEPSWAGGRARDGDSQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1062 | 1062 | Pleckstrin homology domain-containing family G member 5 | PRO_0000307134 | |||||
Regions | |||||||||
| Domain | 392 – 584 | 193 | DH | ||||||
| Domain | 640 – 740 | 101 | PH | ||||||
| Compositional bias | 94 – 99 | 6 | Poly-Glu | ||||||
| Compositional bias | 761 – 781 | 21 | Glu-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 932 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 934 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 959 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 56 | 56 | Missing in isoform 4 and isoform 5. | VSP_036986 | |||||
| Alternative sequence | 1 – 27 | 27 | MDDQS…GRAAK → MGTGPGVSGRLAASRPGPGL PLRDSEPSWAGGRARDGDSQ in isoform 7. | VSP_045964 | |||||
| Alternative sequence | 1 – 19 | 19 | Missing in isoform 3. | VSP_028583 | |||||
| Alternative sequence | 1 – 2 | 2 | MD → MSLGERGSPQTFGGSSVSKG SDAGH in isoform 6. | VSP_044746 | |||||
| Alternative sequence | 1 | 1 | M → MNSVLTKHGSPPRSWLSLCS GT in isoform 2. | VSP_028584 | |||||
| Alternative sequence | 969 – 986 | 18 | GIRTQ…SWDCR → AQEADPGPALPNQDHPAA in isoform 4. | VSP_036987 | |||||
| Alternative sequence | 987 – 1062 | 76 | Missing in isoform 4. | VSP_036988 | |||||
| Natural variant | 703 | 1 | F → S in DSMA4; stability and intracellular location affected severely impairing the NF-kappa-B transduction pathway. Ref.10 | VAR_035357 | |||||
Experimental info | |||||||||
| Sequence conflict | 162 | 1 | P → L in BAH11909. Ref.2 | ||||||
| Sequence conflict | 294 | 1 | T → S in BAA34440. Ref.1 | ||||||
| Sequence conflict | 570 | 1 | M → T in BAG53269. Ref.2 | ||||||
| Sequence conflict | 637 | 1 | E → G in BAC77354. Ref.6 | ||||||
| Sequence conflict | 778 – 779 | 2 | Missing in BAC77354. Ref.6 | ||||||
| Sequence conflict | 960 | 1 | E → G in BAG53269. Ref.2 | ||||||
| Isoform 7: | |||||||||
| Sequence conflict | 38 | 1 | D → E in BAH13058. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 6 AND 7). Tissue: Brain and Teratocarcinoma. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Pancreas and Skin. |
| [6] | "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." Matsuda A., Suzuki Y., Honda G., Muramatsu S., Matsuzaki O., Nagano Y., Doi T., Shimotohno K., Harada T., Nishida E., Hayashi H., Sugano S. Oncogene 22:3307-3318(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 75-1062 (ISOFORM 1), FUNCTION. Tissue: Lung fibroblast. |
| [7] | "The nucleotide sequence of a long cDNA clone isolated from human spleen." Jikuya H., Takano J., Kikuno R., Nagase T., Ohara O. Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 158-1062 (ISOFORM 1). Tissue: Spleen. |
| [8] | "The gene for a new brain specific RhoA exchange factor maps to the highly unstable chromosomal region 1p36.2-1p36.3." De Toledo M., Coulon V., Schmidt S., Fort P., Blangy A. Oncogene 20:7307-7317(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [9] | "A PDZ-binding motif as a critical determinant of Rho guanine exchange factor function and cell phenotype." Liu M., Horowitz A. Mol. Biol. Cell 17:1880-1887(2006) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [10] | "The nuclear factor kappaB-activator gene PLEKHG5 is mutated in a form of autosomal recessive lower motor neuron disease with childhood onset." Maystadt I., Rezsoehazy R., Barkats M., Duque S., Vannuffel P., Remacle S., Lambert B., Najimi M., Sokal E., Munnich A., Viollet L., Verellen-Dumoulin C. Am. J. Hum. Genet. 81:67-76(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DSMA4 SER-703. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB018263 mRNA. Translation: BAA34440.2. Different initiation. AK096347 mRNA. Translation: BAG53269.1. AK294875 mRNA. Translation: BAH11909.1. AK299523 mRNA. Translation: BAH13058.1. AL591866, AL158217 Genomic DNA. Translation: CAI16069.1. AL158217, AL591866 Genomic DNA. Translation: CAI22159.1. AL158217 Genomic DNA. Translation: CAI22161.1. AL158217 Genomic DNA. Translation: CAI22162.1. AL158217 Genomic DNA. Translation: CAI22164.1. AL158217 Genomic DNA. Translation: CAI22165.1. CH471130 Genomic DNA. Translation: EAW71539.1. CH471130 Genomic DNA. Translation: EAW71547.1. BC015231 mRNA. Translation: AAH15231.1. BC042606 mRNA. No translation available. AB097001 mRNA. Translation: BAC77354.1. Sequence problems. AK131074 mRNA. Translation: BAC85124.1. Sequence problems. |
| IPI | IPI00394793. IPI00640076. IPI00642291. IPI00868983. IPI00872583. IPI01010210. IPI01012377. |
| RefSeq | NP_001036128.1. NM_001042663.1. NP_001036129.1. NM_001042664.1. NP_001036130.1. NM_001042665.1. NP_001252521.1. NM_001265592.1. NP_001252522.1. NM_001265593.1. NP_001252523.1. NM_001265594.1. NP_065682.2. NM_020631.4. NP_941374.2. NM_198681.3. |
| UniGene | Hs.284232. Hs.462529. Hs.619982. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1XCG based on UniProtKB O15085. |
| ProteinModelPortal | O94827. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O94827. 2 interactions. |
PTM databases | |
| PhosphoSite | O94827. |
Proteomic databases | |
| PaxDb | O94827. |
| PRIDE | O94827. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000340850; ENSP00000344570; ENSG00000171680. ENST00000377725; ENSP00000366954; ENSG00000171680. ENST00000377728; ENSP00000366957; ENSG00000171680. ENST00000377732; ENSP00000366961; ENSG00000171680. ENST00000377737; ENSP00000366966; ENSG00000171680. ENST00000377748; ENSP00000366977; ENSG00000171680. ENST00000400913; ENSP00000383704; ENSG00000171680. ENST00000400915; ENSP00000383706; ENSG00000171680. ENST00000535355; ENSP00000441445; ENSG00000171680. ENST00000537245; ENSP00000439625; ENSG00000171680. ENST00000544978; ENSP00000437710; ENSG00000171680. |
| GeneID | 57449. |
| KEGG | hsa:57449. |
| UCSC | uc001anj.1. human. uc001anp.1. human. uc009vmb.1. human. |
Organism-specific databases | |
| CTD | 57449. |
| GeneCards | GC01M006526. |
| HGNC | HGNC:29105. PLEKHG5. |
| HPA | HPA049570. |
| MIM | 611067. phenotype. 611101. gene. |
| neXtProt | NX_O94827. |
| Orphanet | 206580. Autosomal recessive lower motor neuron disease with childhood onset. |
| PharmGKB | PA142671164. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG293366. |
| HOVERGEN | HBG058106. |
| OMA | CMEYMRG. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | O94827. |
| Bgee | O94827. |
| CleanEx | HS_PLEKHG5. |
| Genevestigator | O94827. |
Family and domain databases | |
| Gene3D | 1.20.900.10. 1 hit. 2.30.29.30. 1 hit. |
| InterPro | IPR000219. DH-domain. IPR011993. PH_like_dom. IPR001849. Pleckstrin_homology. [Graphical view] |
| Pfam | PF00621. RhoGEF. 1 hit. [Graphical view] |
| SMART | SM00233. PH. 1 hit. SM00325. RhoGEF. 1 hit. [Graphical view] |
| SUPFAM | SSF48065. DH-domain. 1 hit. |
| PROSITE | PS00741. DH_1. False negative. PS50010. DH_2. 1 hit. PS50003. PH_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 57449. |
| NextBio | 63598. |
| SOURCE | Search... |
Entry information
| Entry name | PKHG5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94827 Secondary accession number(s): B3KU07 Q96BS1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
