Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O94788

- AL1A2_HUMAN

UniProt

O94788 - AL1A2_HUMAN

Protein

Retinal dehydrogenase 2

Gene

ALDH1A2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 138 (01 Oct 2014)
      Sequence version 3 (07 Mar 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently By similarity.By similarity

    Catalytic activityi

    Retinal + NAD+ + H2O = retinoate + NADH.

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei187 – 1871Transition state stabilizerBy similarity
    Active sitei286 – 2861Proton acceptorPROSITE-ProRule annotation
    Active sitei320 – 3201NucleophilePROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi263 – 2686NADBy similarity

    GO - Molecular functioni

    1. 3-chloroallyl aldehyde dehydrogenase activity Source: UniProtKB
    2. retinal binding Source: UniProtKB
    3. retinal dehydrogenase activity Source: UniProtKB

    GO - Biological processi

    1. 9-cis-retinoic acid biosynthetic process Source: Ensembl
    2. anterior/posterior pattern specification Source: Ensembl
    3. blood vessel development Source: Ensembl
    4. cardiac muscle tissue development Source: Ensembl
    5. cellular response to retinoic acid Source: Ensembl
    6. determination of bilateral symmetry Source: Ensembl
    7. embryonic camera-type eye development Source: Ensembl
    8. embryonic digestive tract development Source: Ensembl
    9. embryonic forelimb morphogenesis Source: Ensembl
    10. face development Source: Ensembl
    11. heart morphogenesis Source: Ensembl
    12. hindbrain development Source: Ensembl
    13. kidney development Source: Ensembl
    14. liver development Source: Ensembl
    15. lung development Source: Ensembl
    16. midgut development Source: Ensembl
    17. morphogenesis of embryonic epithelium Source: Ensembl
    18. negative regulation of cell proliferation Source: UniProtKB
    19. neural crest cell development Source: Ensembl
    20. neural tube development Source: UniProtKB
    21. neuron differentiation Source: Ensembl
    22. pancreas development Source: Ensembl
    23. pituitary gland development Source: Ensembl
    24. positive regulation of apoptotic process Source: Ensembl
    25. positive regulation of cell proliferation Source: Ensembl
    26. positive regulation of gene expression Source: Ensembl
    27. proximal/distal pattern formation Source: Ensembl
    28. regulation of endothelial cell proliferation Source: Ensembl
    29. response to cytokine Source: UniProtKB
    30. response to estradiol Source: Ensembl
    31. response to vitamin A Source: Ensembl
    32. retinal metabolic process Source: Ensembl
    33. retinoic acid metabolic process Source: UniProtKB
    34. retinoic acid receptor signaling pathway Source: Ensembl
    35. retinol metabolic process Source: UniProtKB-UniPathway
    36. ureter maturation Source: Ensembl
    37. vitamin A metabolic process Source: UniProtKB

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Ligandi

    NAD

    Enzyme and pathway databases

    BioCyciMetaCyc:HS05232-MONOMER.
    UniPathwayiUPA00912.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Retinal dehydrogenase 2 (EC:1.2.1.36)
    Short name:
    RALDH 2
    Short name:
    RalDH2
    Alternative name(s):
    Aldehyde dehydrogenase family 1 member A2
    Retinaldehyde-specific dehydrogenase type 2
    Short name:
    RALDH(II)
    Gene namesi
    Name:ALDH1A2
    Synonyms:RALDH2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:15472. ALDH1A2.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. cytosol Source: Ensembl
    3. perinuclear region of cytoplasm Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24693.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 518518Retinal dehydrogenase 2PRO_0000056422Add
    BLAST

    Proteomic databases

    MaxQBiO94788.
    PaxDbiO94788.
    PRIDEiO94788.

    PTM databases

    PhosphoSiteiO94788.

    Expressioni

    Gene expression databases

    ArrayExpressiO94788.
    BgeeiO94788.
    CleanExiHS_ALDH1A2.
    GenevestigatoriO94788.

    Organism-specific databases

    HPAiHPA010022.

    Interactioni

    Subunit structurei

    Homotetramer.By similarity

    Protein-protein interaction databases

    BioGridi114379. 2 interactions.
    IntActiO94788. 1 interaction.
    STRINGi9606.ENSP00000249750.

    Structurei

    3D structure databases

    ProteinModelPortaliO94788.
    SMRiO94788. Positions 20-518.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the aldehyde dehydrogenase family.Curated

    Phylogenomic databases

    eggNOGiCOG1012.
    HOGENOMiHOG000271505.
    HOVERGENiHBG000097.
    InParanoidiO94788.
    KOiK07249.
    OMAiWINCFNA.
    OrthoDBiEOG7PS1F7.
    PhylomeDBiO94788.
    TreeFamiTF300455.

    Family and domain databases

    Gene3Di3.40.309.10. 1 hit.
    3.40.605.10. 1 hit.
    InterProiIPR016161. Ald_DH/histidinol_DH.
    IPR016163. Ald_DH_C.
    IPR016160. Ald_DH_CS_CYS.
    IPR029510. Ald_DH_CS_GLU.
    IPR016162. Ald_DH_N.
    IPR015590. Aldehyde_DH_dom.
    [Graphical view]
    PfamiPF00171. Aldedh. 1 hit.
    [Graphical view]
    SUPFAMiSSF53720. SSF53720. 1 hit.
    PROSITEiPS00070. ALDEHYDE_DEHYDR_CYS. 1 hit.
    PS00687. ALDEHYDE_DEHYDR_GLU. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O94788-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTSSKIEMPG EVKADPAALM ASLHLLPSPT PNLEIKYTKI FINNEWQNSE    50
    SGRVFPVYNP ATGEQVCEVQ EADKADIDKA VQAARLAFSL GSVWRRMDAS 100
    ERGRLLDKLA DLVERDRAVL ATMESLNGGK PFLQAFYVDL QGVIKTFRYY 150
    AGWADKIHGM TIPVDGDYFT FTRHEPIGVC GQIIPWNFPL LMFAWKIAPA 200
    LCCGNTVVIK PAEQTPLSAL YMGALIKEAG FPPGVINILP GYGPTAGAAI 250
    ASHIGIDKIA FTGSTEVGKL IQEAAGRSNL KRVTLELGGK SPNIIFADAD 300
    LDYAVEQAHQ GVFFNQGQCC TAGSRIFVEE SIYEEFVRRS VERAKRRVVG 350
    SPFDPTTEQG PQIDKKQYNK ILELIQSGVA EGAKLECGGK GLGRKGFFIE 400
    PTVFSNVTDD MRIAKEEIFG PVQEILRFKT MDEVIERANN SDFGLVAAVF 450
    TNDINKALTV SSAMQAGTVW INCYNALNAQ SPFGGFKMSG NGREMGEFGL 500
    REYSEVKTVT VKIPQKNS 518
    Length:518
    Mass (Da):56,724
    Last modified:March 7, 2006 - v3
    Checksum:iAAEE7A886951373F
    GO
    Isoform 2 (identifier: O94788-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         229-266: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:480
    Mass (Da):53,060
    Checksum:i5AC931BE5ED26AA4
    GO
    Isoform 3 (identifier: O94788-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTK → MKNQCETVWLKSPIKLKL

    Note: No experimental confirmation available.

    Show »
    Length:497
    Mass (Da):54,673
    Checksum:i27E8A8307A680BB7
    GO
    Isoform 4 (identifier: O94788-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-96: Missing.

    Show »
    Length:422
    Mass (Da):46,137
    Checksum:i4927D07BDD3BAC5D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti231 – 2311F → L in BAG64174. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti50 – 501E → G.1 Publication
    Corresponds to variant rs34266719 [ dbSNP | Ensembl ].
    VAR_025439
    Natural varianti110 – 1101A → V.1 Publication
    Corresponds to variant rs35365164 [ dbSNP | Ensembl ].
    VAR_025440
    Natural varianti348 – 3481V → I.4 Publications
    Corresponds to variant rs4646626 [ dbSNP | Ensembl ].
    VAR_025441
    Natural varianti436 – 4361E → K.1 Publication
    Corresponds to variant rs34744827 [ dbSNP | Ensembl ].
    VAR_025442

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 9696Missing in isoform 4. 1 PublicationVSP_047259Add
    BLAST
    Alternative sequencei1 – 3939MTSSK…IKYTK → MKNQCETVWLKSPIKLKL in isoform 3. 1 PublicationVSP_044496Add
    BLAST
    Alternative sequencei229 – 26638Missing in isoform 2. 1 PublicationVSP_017363Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB015226 mRNA. Translation: BAA34785.1.
    AB015227 mRNA. Translation: BAA34786.1.
    AB015228 mRNA. Translation: BAA34787.1.
    AK128709 mRNA. Translation: BAG54714.1.
    AK303057 mRNA. Translation: BAG64174.1.
    DQ322171 Genomic DNA. Translation: ABC40749.1.
    AC012653 Genomic DNA. No translation available.
    AC018904 Genomic DNA. No translation available.
    AC025431 Genomic DNA. No translation available.
    AC066616 Genomic DNA. No translation available.
    AC084781 Genomic DNA. No translation available.
    BC030589 mRNA. Translation: AAH30589.1.
    AL110299 mRNA. Translation: CAB53740.2.
    CCDSiCCDS10163.1. [O94788-1]
    CCDS10164.1. [O94788-2]
    CCDS45266.1. [O94788-4]
    CCDS55968.1. [O94788-3]
    PIRiT14799.
    RefSeqiNP_001193826.1. NM_001206897.1. [O94788-3]
    NP_003879.2. NM_003888.3. [O94788-1]
    NP_733797.1. NM_170696.2. [O94788-2]
    NP_733798.1. NM_170697.2. [O94788-4]
    UniGeneiHs.643455.

    Genome annotation databases

    EnsembliENST00000249750; ENSP00000249750; ENSG00000128918. [O94788-1]
    ENST00000347587; ENSP00000309623; ENSG00000128918. [O94788-2]
    ENST00000537372; ENSP00000438296; ENSG00000128918. [O94788-3]
    ENST00000559517; ENSP00000453408; ENSG00000128918. [O94788-4]
    GeneIDi8854.
    KEGGihsa:8854.
    UCSCiuc002aew.3. human. [O94788-1]
    uc002aey.3. human. [O94788-2]
    uc010ugv.2. human. [O94788-3]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB015226 mRNA. Translation: BAA34785.1 .
    AB015227 mRNA. Translation: BAA34786.1 .
    AB015228 mRNA. Translation: BAA34787.1 .
    AK128709 mRNA. Translation: BAG54714.1 .
    AK303057 mRNA. Translation: BAG64174.1 .
    DQ322171 Genomic DNA. Translation: ABC40749.1 .
    AC012653 Genomic DNA. No translation available.
    AC018904 Genomic DNA. No translation available.
    AC025431 Genomic DNA. No translation available.
    AC066616 Genomic DNA. No translation available.
    AC084781 Genomic DNA. No translation available.
    BC030589 mRNA. Translation: AAH30589.1 .
    AL110299 mRNA. Translation: CAB53740.2 .
    CCDSi CCDS10163.1. [O94788-1 ]
    CCDS10164.1. [O94788-2 ]
    CCDS45266.1. [O94788-4 ]
    CCDS55968.1. [O94788-3 ]
    PIRi T14799.
    RefSeqi NP_001193826.1. NM_001206897.1. [O94788-3 ]
    NP_003879.2. NM_003888.3. [O94788-1 ]
    NP_733797.1. NM_170696.2. [O94788-2 ]
    NP_733798.1. NM_170697.2. [O94788-4 ]
    UniGenei Hs.643455.

    3D structure databases

    ProteinModelPortali O94788.
    SMRi O94788. Positions 20-518.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114379. 2 interactions.
    IntActi O94788. 1 interaction.
    STRINGi 9606.ENSP00000249750.

    Chemistry

    DrugBanki DB00157. NADH.
    DB00755. Tretinoin.
    DB00162. Vitamin A.

    PTM databases

    PhosphoSitei O94788.

    Proteomic databases

    MaxQBi O94788.
    PaxDbi O94788.
    PRIDEi O94788.

    Protocols and materials databases

    DNASUi 8854.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000249750 ; ENSP00000249750 ; ENSG00000128918 . [O94788-1 ]
    ENST00000347587 ; ENSP00000309623 ; ENSG00000128918 . [O94788-2 ]
    ENST00000537372 ; ENSP00000438296 ; ENSG00000128918 . [O94788-3 ]
    ENST00000559517 ; ENSP00000453408 ; ENSG00000128918 . [O94788-4 ]
    GeneIDi 8854.
    KEGGi hsa:8854.
    UCSCi uc002aew.3. human. [O94788-1 ]
    uc002aey.3. human. [O94788-2 ]
    uc010ugv.2. human. [O94788-3 ]

    Organism-specific databases

    CTDi 8854.
    GeneCardsi GC15M058245.
    H-InvDB HIX0038341.
    HGNCi HGNC:15472. ALDH1A2.
    HPAi HPA010022.
    MIMi 603687. gene.
    neXtProti NX_O94788.
    PharmGKBi PA24693.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1012.
    HOGENOMi HOG000271505.
    HOVERGENi HBG000097.
    InParanoidi O94788.
    KOi K07249.
    OMAi WINCFNA.
    OrthoDBi EOG7PS1F7.
    PhylomeDBi O94788.
    TreeFami TF300455.

    Enzyme and pathway databases

    UniPathwayi UPA00912 .
    BioCyci MetaCyc:HS05232-MONOMER.

    Miscellaneous databases

    ChiTaRSi ALDH1A2. human.
    GeneWikii ALDH1A2.
    GenomeRNAii 8854.
    NextBioi 33241.
    PROi O94788.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O94788.
    Bgeei O94788.
    CleanExi HS_ALDH1A2.
    Genevestigatori O94788.

    Family and domain databases

    Gene3Di 3.40.309.10. 1 hit.
    3.40.605.10. 1 hit.
    InterProi IPR016161. Ald_DH/histidinol_DH.
    IPR016163. Ald_DH_C.
    IPR016160. Ald_DH_CS_CYS.
    IPR029510. Ald_DH_CS_GLU.
    IPR016162. Ald_DH_N.
    IPR015590. Aldehyde_DH_dom.
    [Graphical view ]
    Pfami PF00171. Aldedh. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53720. SSF53720. 1 hit.
    PROSITEi PS00070. ALDEHYDE_DEHYDR_CYS. 1 hit.
    PS00687. ALDEHYDE_DEHYDR_GLU. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "TAL1 and LIM-only proteins synergistically induce retinaldehyde dehydrogenase 2 expression in T-cell acute lymphoblastic leukemia by acting as cofactors for GATA3."
      Ono Y., Fukuhara N., Yoshie O.
      Mol. Cell. Biol. 18:6939-6950(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), VARIANT ILE-348.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT ILE-348.
      Tissue: Testis and Uterus.
    3. NIEHS SNPs program
      Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLY-50; VAL-110; ILE-348 AND LYS-436.
    4. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 302-518 (ISOFORMS 1/2), VARIANT ILE-348.
      Tissue: Testis.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiAL1A2_HUMAN
    AccessioniPrimary (citable) accession number: O94788
    Secondary accession number(s): B3KY52
    , B4DZR2, F5H2Y9, H0YM00, Q2PJS6, Q8NHQ4, Q9UBR8, Q9UFY0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: March 7, 2006
    Last modified: October 1, 2014
    This is version 138 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3