O94788 (AL1A2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Retinal dehydrogenase 2 Short name=RALDH 2 Short name=RalDH2 EC=1.2.1.36 Alternative name(s): Aldehyde dehydrogenase family 1 member A2 Retinaldehyde-specific dehydrogenase type 2 Short name=RALDH(II) | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 518 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently By similarity. |
| Catalytic activity | Retinal + NAD+ + H2O = retinoate + NADH. |
| Pathway | |
| Subunit structure | Homotetramer By similarity. |
| Subcellular location | |
| Sequence similarities | Belongs to the aldehyde dehydrogenase family. |
| Sequence caution | The sequence BAA34786.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA34787.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94788-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94788-2) The sequence of this isoform differs from the canonical sequence as follows: 229-266: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O94788-3) The sequence of this isoform differs from the canonical sequence as follows: 1-39: MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTK → MKNQCETVWLKSPIKLKL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 518 | 518 | Retinal dehydrogenase 2 | PRO_0000056422 | |||||
Regions | |||||||||
| Nucleotide binding | 263 – 268 | 6 | NAD By similarity | ||||||
Sites | |||||||||
| Active site | 286 | 1 | Proton acceptor By similarity | ||||||
| Active site | 320 | 1 | Nucleophile By similarity | ||||||
| Site | 187 | 1 | Transition state stabilizer By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 122 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 39 | 39 | MTSSK…IKYTK → MKNQCETVWLKSPIKLKL in isoform 3. | VSP_044496 | |||||
| Alternative sequence | 229 – 266 | 38 | Missing in isoform 2. | VSP_017363 | |||||
| Natural variant | 50 | 1 | E → G. Ref.3 Corresponds to variant rs34266719 [ dbSNP | Ensembl ]. | VAR_025439 | |||||
| Natural variant | 110 | 1 | A → V. Ref.3 Corresponds to variant rs35365164 [ dbSNP | Ensembl ]. | VAR_025440 | |||||
| Natural variant | 348 | 1 | V → I. Ref.1 Ref.2 Ref.3 Ref.6 Corresponds to variant rs4646626 [ dbSNP | Ensembl ]. | VAR_025441 | |||||
| Natural variant | 436 | 1 | E → K. Ref.3 Corresponds to variant rs34744827 [ dbSNP | Ensembl ]. | VAR_025442 | |||||
Experimental info | |||||||||
| Sequence conflict | 231 | 1 | F → L in BAG64174. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "TAL1 and LIM-only proteins synergistically induce retinaldehyde dehydrogenase 2 expression in T-cell acute lymphoblastic leukemia by acting as cofactors for GATA3." Ono Y., Fukuhara N., Yoshie O. Mol. Cell. Biol. 18:6939-6950(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ILE-348. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT ILE-348. Tissue: Testis and Uterus. |
| [3] | NIEHS SNPs program Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLY-50; VAL-110; ILE-348 AND LYS-436. |
| [4] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 302-518 (ISOFORMS 1/2), VARIANT ILE-348. Tissue: Testis. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB015226 mRNA. Translation: BAA34785.1. AB015227 mRNA. Translation: BAA34786.1. Different initiation. AB015228 mRNA. Translation: BAA34787.1. Different initiation. AK128709 mRNA. Translation: BAG54714.1. AK303057 mRNA. Translation: BAG64174.1. DQ322171 Genomic DNA. Translation: ABC40749.1. AC012653 Genomic DNA. No translation available. AC018904 Genomic DNA. No translation available. AC025431 Genomic DNA. No translation available. AC066616 Genomic DNA. No translation available. AC084781 Genomic DNA. No translation available. BC030589 mRNA. Translation: AAH30589.1. AL110299 mRNA. Translation: CAB53740.2. |
| IPI | IPI00169288. IPI00216805. IPI01011430. |
| PIR | T14799. |
| RefSeq | NP_001193826.1. NM_001206897.1. NP_003879.2. NM_003888.3. NP_733797.1. NM_170696.2. NP_733798.1. NM_170697.2. |
| UniGene | Hs.643455. |
3D structure databases | |
| ProteinModelPortal | O94788. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O94788. 1 interaction. |
| STRING | 9606.ENSP00000249750. |
PTM databases | |
| PhosphoSite | O94788. |
Proteomic databases | |
| PaxDb | O94788. |
| PRIDE | O94788. |
Protocols and materials databases | |
| DNASU | 8854. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000249750; ENSP00000249750; ENSG00000128918. ENST00000347587; ENSP00000309623; ENSG00000128918. ENST00000537372; ENSP00000438296; ENSG00000128918. |
| GeneID | 8854. |
| KEGG | hsa:8854. |
| UCSC | uc002aew.3. human. uc002aey.3. human. |
Organism-specific databases | |
| CTD | 8854. |
| GeneCards | GC15M058245. |
| H-InvDB | HIX0038341. |
| HGNC | HGNC:15472. ALDH1A2. |
| HPA | HPA010022. |
| MIM | 603687. gene. |
| neXtProt | NX_O94788. |
| PharmGKB | PA24693. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1012. |
| HOGENOM | HOG000271505. |
| HOVERGEN | HBG000097. |
| InParanoid | O94788. |
| KO | K07249. |
| OMA | ICEIQEA. |
| OrthoDB | EOG4Z8XW6. |
| PhylomeDB | O94788. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS05232-MONOMER. |
| UniPathway | UPA00912. |
Gene expression databases | |
| ArrayExpress | O94788. |
| Bgee | O94788. |
| CleanEx | HS_ALDH1A2. |
| Genevestigator | O94788. |
| GermOnline | ENSG00000128918. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.309.10. 1 hit. 3.40.605.10. 1 hit. |
| InterPro | IPR016161. Ald_DH/histidinol_DH. IPR016163. Ald_DH_C. IPR016160. Ald_DH_CS. IPR016162. Ald_DH_N. IPR015590. Aldehyde_DH_dom. [Graphical view] |
| Pfam | PF00171. Aldedh. 1 hit. [Graphical view] |
| SUPFAM | SSF53720. Aldehyde_DH/Histidinol_DH. 1 hit. |
| PROSITE | PS00070. ALDEHYDE_DEHYDR_CYS. 1 hit. PS00687. ALDEHYDE_DEHYDR_GLU. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ALDH1A2. human. |
| DrugBank | DB00157. NADH. DB00755. Tretinoin. DB00162. Vitamin A. |
| GenomeRNAi | 8854. |
| NextBio | 33241. |
| SOURCE | Search... |
Entry information
| Entry name | AL1A2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94788 Secondary accession number(s): B3KY52 Q9UFY0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
