Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O94766

- B3GA3_HUMAN

UniProt

O94766 - B3GA3_HUMAN

Protein

Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3

Gene

B3GAT3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 144 (01 Oct 2014)
      Sequence version 2 (26 Apr 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Glycosaminoglycans biosynthesis. Involved in forming the linkage tetrasaccharide present in heparan sulfate and chondroitin sulfate. Transfers a glucuronic acid moiety from the uridine diphosphate-glucuronic acid (UDP-GlcUA) to the common linkage region trisaccharide Gal-beta-1,3-Gal-beta-1,4-Xyl covalently bound to a Ser residue at the glycosaminylglycan attachment site of proteoglycans. Can also play a role in the biosynthesis of l2/HNK-1 carbohydrate epitope on glycoproteins. Shows strict specificity for Gal-beta-1,3-Gal-beta-1,4-Xyl, exhibiting negligible incorporation into other galactoside substrates including Galbeta1-3Gal beta1-O-benzyl, Galbeta1-4GlcNAc and Galbeta1-4Glc.

    Catalytic activityi

    UDP-glucuronate + 3-beta-D-galactosyl-4-beta-D-galactosyl-O-beta-D-xylosylprotein = UDP + 3-beta-D-glucuronosyl-3-beta-D-galactosyl-4-beta-D-galactosyl-O-beta-D-xylosylprotein.

    Cofactori

    Manganese.

    Enzyme regulationi

    Inhibited by EDTA.

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei113 – 1131UDP-glucuronate
    Binding sitei156 – 1561UDP-glucuronate
    Binding sitei161 – 1611UDP-glucuronate
    Metal bindingi196 – 1961Manganese
    Sitei227 – 2271Interaction with galactose moiety of substrate glycoprotein
    Active sitei281 – 2811Proton donor/acceptor1 Publication
    Sitei318 – 3181Interaction with galactose moiety of substrate glycoprotein

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi82 – 843UDP-glucuronate binding
    Nucleotide bindingi194 – 1963UDP-glucuronate binding
    Nucleotide bindingi308 – 3103UDP-glucuronate binding

    GO - Molecular functioni

    1. galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity Source: UniProtKB
    2. glucuronosyltransferase activity Source: MGI
    3. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. carbohydrate metabolic process Source: Reactome
    2. chondroitin sulfate metabolic process Source: Reactome
    3. chondroitin sulfate proteoglycan biosynthetic process Source: MGI
    4. dermatan sulfate proteoglycan biosynthetic process Source: MGI
    5. glycosaminoglycan biosynthetic process Source: UniProtKB
    6. glycosaminoglycan metabolic process Source: Reactome
    7. heparan sulfate proteoglycan biosynthetic process Source: MGI
    8. protein glycosylation Source: UniProtKB-UniPathway
    9. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Transferase

    Keywords - Ligandi

    Manganese, Metal-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS07624-MONOMER.
    ReactomeiREACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
    UniPathwayiUPA00378.

    Protein family/group databases

    CAZyiGT43. Glycosyltransferase Family 43.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 (EC:2.4.1.135)
    Alternative name(s):
    Beta-1,3-glucuronyltransferase 3
    Glucuronosyltransferase I
    Short name:
    GlcAT-I
    UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase
    Short name:
    GlcUAT-I
    Gene namesi
    Name:B3GAT3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:923. B3GAT3.

    Subcellular locationi

    Golgi apparatus membrane 1 Publication; Single-pass type II membrane protein 1 Publication. Golgi apparatuscis-Golgi network 1 Publication

    GO - Cellular componenti

    1. cis-Golgi network Source: UniProtKB
    2. extracellular vesicular exosome Source: UniProt
    3. Golgi apparatus Source: MGI
    4. Golgi membrane Source: Reactome
    5. integral component of membrane Source: UniProtKB
    6. membrane Source: UniProtKB

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Multiple joint dislocations short stature craniofacial dysmorphism and congenital heart defects (JDSSDHD) [MIM:245600]: An autosomal recessive disease characterized by dysmorphic facies, bilateral dislocations of the elbows, hips, and knees, clubfeet, and short stature, as well as cardiovascular defects.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti277 – 2771R → Q in JDSSDHD; reduced activity; patient fibroblasts have decreased levels of dermatan sulfate, chondroitin sulfate and heparan sulfate proteoglycans. 1 Publication
    VAR_066624

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi33 – 331C → A: Loss of dimer formation and reduced activity. 1 Publication
    Mutagenesisi301 – 3011C → A: Enzyme inactivation and loss of glycosylation. 1 Publication

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    MIMi245600. phenotype.
    Orphaneti284139. Larsen-like syndrome, B3GAT3 type.
    PharmGKBiPA25217.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 335335Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3PRO_0000195176Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi33 – 33Interchain
    Glycosylationi300 – 3001N-linked (GlcNAc...)

    Post-translational modificationi

    N-glycosylated.

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiO94766.
    PaxDbiO94766.
    PRIDEiO94766.

    PTM databases

    PhosphoSiteiO94766.

    Expressioni

    Tissue specificityi

    Ubiquitous (but weakly expressed in all tissues examined).

    Gene expression databases

    ArrayExpressiO94766.
    BgeeiO94766.
    CleanExiHS_B3GAT3.
    GenevestigatoriO94766.

    Organism-specific databases

    HPAiHPA051328.

    Interactioni

    Subunit structurei

    Homodimer; disulfide-linked.3 Publications

    Protein-protein interaction databases

    BioGridi117620. 4 interactions.
    IntActiO94766. 1 interaction.
    STRINGi9606.ENSP00000265471.

    Structurei

    Secondary structure

    1
    335
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi76 – 838
    Helixi89 – 10012
    Beta strandi103 – 11614
    Helixi119 – 12810
    Beta strandi130 – 1367
    Helixi158 – 16811
    Beta strandi174 – 1774
    Beta strandi188 – 1925
    Beta strandi197 – 1993
    Helixi201 – 2077
    Beta strandi211 – 2155
    Beta strandi218 – 2214
    Beta strandi224 – 2329
    Beta strandi235 – 2406
    Helixi253 – 2553
    Beta strandi256 – 2594
    Helixi260 – 2656
    Helixi280 – 2856
    Turni286 – 2883
    Helixi291 – 2933
    Helixi298 – 3014
    Helixi317 – 3237
    Turni324 – 3263

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1FGGX-ray2.30A/B76-335[»]
    1KWSX-ray2.10A/B76-335[»]
    3CU0X-ray1.90A/B76-335[»]
    ProteinModelPortaliO94766.
    SMRiO94766. Positions 76-335.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO94766.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 77CytoplasmicSequence Analysis
    Topological domaini29 – 335307LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei8 – 2821Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni243 – 25210Interaction with galactose moiety of substrate glycoprotein

    Sequence similaritiesi

    Belongs to the glycosyltransferase 43 family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG310844.
    HOVERGENiHBG050650.
    InParanoidiO94766.
    KOiK10158.
    OMAiPNAQFDS.
    OrthoDBiEOG7QG44X.
    PhylomeDBiO94766.
    TreeFamiTF313522.

    Family and domain databases

    Gene3Di3.90.550.10. 1 hit.
    InterProiIPR005027. Glyco_trans_43.
    IPR029044. Nucleotide-diphossugar_trans.
    [Graphical view]
    PANTHERiPTHR10896. PTHR10896. 1 hit.
    PfamiPF03360. Glyco_transf_43. 1 hit.
    [Graphical view]
    SUPFAMiSSF53448. SSF53448. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O94766-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKLKLKNVFL AYFLVSIAGL LYALVQLGQP CDCLPPLRAA AEQLRQKDLR    50
    ISQLQAELRR PPPAPAQPPE PEALPTIYVV TPTYARLVQK AELVRLSQTL 100
    SLVPRLHWLL VEDAEGPTPL VSGLLAASGL LFTHLVVLTP KAQRLREGEP 150
    GWVHPRGVEQ RNKALDWLRG RGGAVGGEKD PPPPGTQGVV YFADDDNTYS 200
    RELFEEMRWT RGVSVWPVGL VGGLRFEGPQ VQDGRVVGFH TAWEPSRPFP 250
    VDMAGFAVAL PLLLDKPNAQ FDSTAPRGHL ESSLLSHLVD PKDLEPRAAN 300
    CTRVLVWHTR TEKPKMKQEE QLQRQGRGSD PAIEV 335
    Length:335
    Mass (Da):37,122
    Last modified:April 26, 2004 - v2
    Checksum:i5EC45408597F1C0F
    GO
    Isoform 2 (identifier: O94766-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         304-335: VLVWHTRTEKPKMKQEEQLQRQGRGSDPAIEV → TESRCVTQAGVQ

    Note: No experimental confirmation available.

    Show »
    Length:315
    Mass (Da):34,625
    Checksum:iC0CE4A035B38E626
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti204 – 2041F → S in BAA34537. (PubMed:9506957)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti277 – 2771R → Q in JDSSDHD; reduced activity; patient fibroblasts have decreased levels of dermatan sulfate, chondroitin sulfate and heparan sulfate proteoglycans. 1 Publication
    VAR_066624

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei304 – 33532VLVWH…PAIEV → TESRCVTQAGVQ in isoform 2. 1 PublicationVSP_056347Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009598 mRNA. Translation: BAA34537.1.
    AK316228 mRNA. Translation: BAH14599.1.
    AP001458 Genomic DNA. No translation available.
    BC007906 mRNA. Translation: AAH07906.1.
    BC071961 mRNA. Translation: AAH71961.1.
    AJ005865 mRNA. Translation: CAA06742.1.
    CCDSiCCDS8025.1.
    RefSeqiNP_001275652.1. NM_001288723.1.
    NP_036332.2. NM_012200.3.
    UniGeneiHs.502759.

    Genome annotation databases

    EnsembliENST00000265471; ENSP00000265471; ENSG00000149541.
    ENST00000534026; ENSP00000432474; ENSG00000149541.
    GeneIDi26229.
    KEGGihsa:26229.
    UCSCiuc001ntw.3. human.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    GGDB

    GlycoGene database

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009598 mRNA. Translation: BAA34537.1 .
    AK316228 mRNA. Translation: BAH14599.1 .
    AP001458 Genomic DNA. No translation available.
    BC007906 mRNA. Translation: AAH07906.1 .
    BC071961 mRNA. Translation: AAH71961.1 .
    AJ005865 mRNA. Translation: CAA06742.1 .
    CCDSi CCDS8025.1.
    RefSeqi NP_001275652.1. NM_001288723.1.
    NP_036332.2. NM_012200.3.
    UniGenei Hs.502759.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1FGG X-ray 2.30 A/B 76-335 [» ]
    1KWS X-ray 2.10 A/B 76-335 [» ]
    3CU0 X-ray 1.90 A/B 76-335 [» ]
    ProteinModelPortali O94766.
    SMRi O94766. Positions 76-335.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117620. 4 interactions.
    IntActi O94766. 1 interaction.
    STRINGi 9606.ENSP00000265471.

    Protein family/group databases

    CAZyi GT43. Glycosyltransferase Family 43.

    PTM databases

    PhosphoSitei O94766.

    Proteomic databases

    MaxQBi O94766.
    PaxDbi O94766.
    PRIDEi O94766.

    Protocols and materials databases

    DNASUi 26229.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000265471 ; ENSP00000265471 ; ENSG00000149541 .
    ENST00000534026 ; ENSP00000432474 ; ENSG00000149541 .
    GeneIDi 26229.
    KEGGi hsa:26229.
    UCSCi uc001ntw.3. human.

    Organism-specific databases

    CTDi 26229.
    GeneCardsi GC11M062429.
    HGNCi HGNC:923. B3GAT3.
    HPAi HPA051328.
    MIMi 245600. phenotype.
    606374. gene.
    neXtProti NX_O94766.
    Orphaneti 284139. Larsen-like syndrome, B3GAT3 type.
    PharmGKBi PA25217.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG310844.
    HOVERGENi HBG050650.
    InParanoidi O94766.
    KOi K10158.
    OMAi PNAQFDS.
    OrthoDBi EOG7QG44X.
    PhylomeDBi O94766.
    TreeFami TF313522.

    Enzyme and pathway databases

    UniPathwayi UPA00378 .
    BioCyci MetaCyc:HS07624-MONOMER.
    Reactomei REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.

    Miscellaneous databases

    ChiTaRSi B3GAT3. human.
    EvolutionaryTracei O94766.
    GeneWikii B3GAT3.
    GenomeRNAii 26229.
    NextBioi 48391.
    PROi O94766.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O94766.
    Bgeei O94766.
    CleanExi HS_B3GAT3.
    Genevestigatori O94766.

    Family and domain databases

    Gene3Di 3.90.550.10. 1 hit.
    InterProi IPR005027. Glyco_trans_43.
    IPR029044. Nucleotide-diphossugar_trans.
    [Graphical view ]
    PANTHERi PTHR10896. PTHR10896. 1 hit.
    Pfami PF03360. Glyco_transf_43. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53448. SSF53448. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and expression of glucuronyltransferase I involved in the biosynthesis of the glycosaminoglycan-protein linkage region of proteoglycans."
      Kitagawa H., Tone Y., Tamura J., Neumann K.W., Ogawa T., Oka S., Kawasaki T., Sugahara K.
      J. Biol. Chem. 273:6615-6618(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
      Tissue: Placenta.
    2. "Structure/function of the human Ga1beta1,3-glucuronosyltransferase. Dimerization and functional activity are mediated by two crucial cysteine residues."
      Ouzzine M., Gulberti S., Netter P., Magdalou J., Fournel-Gigleux S.
      J. Biol. Chem. 275:28254-28260(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION, MUTAGENESIS.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Eye and Skin.
    6. "Three proteins involved in Caenorhabditis elegans vulval invagination are similar to components of a glycosylation pathway."
      Herman T., Horvitz H.R.
      Proc. Natl. Acad. Sci. U.S.A. 96:974-979(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 9-335 (ISOFORM 1).
      Tissue: Brain.
    7. "Characterization of recombinant human glucuronyltransferase I involved in the biosynthesis of the glycosaminoglycan-protein linkage region of proteoglycans."
      Tone Y., Kitagawa H., Imiya K., Oka S., Kawasaki T., Sugahara K.
      FEBS Lett. 459:415-420(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.
    8. Cited for: SUBCELLULAR LOCATION, VARIANT JDSSDHD GLN-277, CHARACTERIZATION OF VARIANT JDSSDHD GLN-277.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "Heparan/chondroitin sulfate biosynthesis. Structure and mechanism of human glucuronyltransferase I."
      Pedersen L.C., Tsuchida K., Kitagawa H., Sugahara K., Darden T.A., Negishi M.
      J. Biol. Chem. 275:34580-34585(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.30 ANGSTROMS) OF 76-335 IN COMPLEX WITH UDP-GLUCURONIC ACID AND GALACTOSE MOIETY OF SUBSTRATE GLYCOPROTEIN.
      Tissue: Liver.
    11. "Crystal structure of beta 1,3-glucuronyltransferase I in complex with active donor substrate UDP-GlcUA."
      Pedersen L.C., Darden T.A., Negishi M.
      J. Biol. Chem. 277:21869-21873(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 76-335 IN COMPLEX WITH UDP-GLUCURONIC ACID, ACTIVE SITE.
    12. "2-o-phosphorylation of xylose and 6-O-sulfation of galactose in the protein linkage region of glycosaminoglycans influence the glucuronyltransferase-I activity involved in the linkage region synthesis."
      Tone Y., Pedersen L.C., Yamamoto T., Izumikawa T., Kitagawa H., Nishihara J., Tamura J., Negishi M., Sugahara K.
      J. Biol. Chem. 283:16801-16807(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.90 ANGSTROMS) OF 76-335 IN COMPLEX WITH URIDINE-5'-DIPHOSPHATE AND GALACTOSE MOIETY OF SUBSTRATE GLYCOPROTEIN.

    Entry informationi

    Entry nameiB3GA3_HUMAN
    AccessioniPrimary (citable) accession number: O94766
    Secondary accession number(s): B7ZAB3, Q96I06, Q9UEP0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 2001
    Last sequence update: April 26, 2004
    Last modified: October 1, 2014
    This is version 144 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3