Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O94766

- B3GA3_HUMAN

UniProt

O94766 - B3GA3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3

Gene

B3GAT3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Glycosaminoglycans biosynthesis. Involved in forming the linkage tetrasaccharide present in heparan sulfate and chondroitin sulfate. Transfers a glucuronic acid moiety from the uridine diphosphate-glucuronic acid (UDP-GlcUA) to the common linkage region trisaccharide Gal-beta-1,3-Gal-beta-1,4-Xyl covalently bound to a Ser residue at the glycosaminylglycan attachment site of proteoglycans. Can also play a role in the biosynthesis of l2/HNK-1 carbohydrate epitope on glycoproteins. Shows strict specificity for Gal-beta-1,3-Gal-beta-1,4-Xyl, exhibiting negligible incorporation into other galactoside substrates including Galbeta1-3Gal beta1-O-benzyl, Galbeta1-4GlcNAc and Galbeta1-4Glc. Stimulates 2-phosphoxylose phosphatase activity of PXYLP1 in presence of uridine diphosphate-glucuronic acid (UDP-GlcUA) during completion of linkage region formation.1 Publication

Catalytic activityi

UDP-glucuronate + 3-beta-D-galactosyl-4-beta-D-galactosyl-O-beta-D-xylosylprotein = UDP + 3-beta-D-glucuronosyl-3-beta-D-galactosyl-4-beta-D-galactosyl-O-beta-D-xylosylprotein.

Cofactori

Enzyme regulationi

Inhibited by EDTA.

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei113 – 1131UDP-glucuronate
Binding sitei156 – 1561UDP-glucuronate
Binding sitei161 – 1611UDP-glucuronate
Metal bindingi196 – 1961Manganese
Sitei227 – 2271Interaction with galactose moiety of substrate glycoprotein
Active sitei281 – 2811Proton donor/acceptor1 Publication
Sitei318 – 3181Interaction with galactose moiety of substrate glycoprotein

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi82 – 843UDP-glucuronate binding
Nucleotide bindingi194 – 1963UDP-glucuronate binding
Nucleotide bindingi308 – 3103UDP-glucuronate binding

GO - Molecular functioni

  1. galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity Source: UniProtKB
  2. glucuronosyltransferase activity Source: MGI
  3. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. carbohydrate metabolic process Source: Reactome
  2. chondroitin sulfate metabolic process Source: Reactome
  3. chondroitin sulfate proteoglycan biosynthetic process Source: MGI
  4. dermatan sulfate proteoglycan biosynthetic process Source: MGI
  5. glycosaminoglycan biosynthetic process Source: UniProtKB
  6. glycosaminoglycan metabolic process Source: Reactome
  7. heparan sulfate proteoglycan biosynthetic process Source: MGI
  8. protein glycosylation Source: UniProtKB-UniPathway
  9. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Ligandi

Manganese, Metal-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS07624-MONOMER.
ReactomeiREACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
UniPathwayiUPA00378.

Protein family/group databases

CAZyiGT43. Glycosyltransferase Family 43.

Names & Taxonomyi

Protein namesi
Recommended name:
Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 (EC:2.4.1.135)
Alternative name(s):
Beta-1,3-glucuronyltransferase 3
Glucuronosyltransferase I
Short name:
GlcAT-I
UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase
Short name:
GlcUAT-I
Gene namesi
Name:B3GAT3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:923. B3GAT3.

Subcellular locationi

Golgi apparatus membrane 1 Publication; Single-pass type II membrane protein 1 Publication. Golgi apparatuscis-Golgi network 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 77CytoplasmicSequence Analysis
Transmembranei8 – 2821Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST
Topological domaini29 – 335307LumenalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cis-Golgi network Source: UniProtKB
  2. extracellular vesicular exosome Source: UniProt
  3. Golgi apparatus Source: MGI
  4. Golgi membrane Source: Reactome
  5. integral component of membrane Source: UniProtKB
  6. membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Involvement in diseasei

Multiple joint dislocations short stature craniofacial dysmorphism and congenital heart defects (JDSSDHD) [MIM:245600]: An autosomal recessive disease characterized by dysmorphic facies, bilateral dislocations of the elbows, hips, and knees, clubfeet, and short stature, as well as cardiovascular defects.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti277 – 2771R → Q in JDSSDHD; reduced activity; patient fibroblasts have decreased levels of dermatan sulfate, chondroitin sulfate and heparan sulfate proteoglycans. 1 Publication
VAR_066624

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi33 – 331C → A: Loss of dimer formation and reduced activity. 1 Publication
Mutagenesisi281 – 2811E → A: Absence of enzymatic activity in presence of uridine diphosphate-glucuronic acid (UDP-GlcUA). Does not increase PXYLP1-induced 2-phosphoxylose phosphatase activity in presence of uridine diphosphate-glucuronic acid (UDP-GlcUA). 1 Publication1 Publication
Mutagenesisi301 – 3011C → A: Enzyme inactivation and loss of glycosylation. 1 Publication

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi245600. phenotype.
Orphaneti284139. Larsen-like syndrome, B3GAT3 type.
PharmGKBiPA25217.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 335335Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3PRO_0000195176Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi33 – 33Interchain
Glycosylationi300 – 3001N-linked (GlcNAc...)

Post-translational modificationi

N-glycosylated.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiO94766.
PaxDbiO94766.
PRIDEiO94766.

PTM databases

PhosphoSiteiO94766.

Expressioni

Tissue specificityi

Ubiquitous (but weakly expressed in all tissues examined).

Gene expression databases

BgeeiO94766.
CleanExiHS_B3GAT3.
ExpressionAtlasiO94766. baseline and differential.
GenevestigatoriO94766.

Organism-specific databases

HPAiHPA051328.

Interactioni

Subunit structurei

Homodimer; disulfide-linked. Interacts with PXYLP1; the interaction increases the 2-phosphoxylose phosphatase activity of PXYLP1 during completion of linkage region formation in a B3GAT3-mediated manner.4 Publications

Protein-protein interaction databases

BioGridi117620. 20 interactions.
IntActiO94766. 1 interaction.
STRINGi9606.ENSP00000265471.

Structurei

Secondary structure

1
335
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi76 – 838Combined sources
Helixi89 – 10012Combined sources
Beta strandi103 – 11614Combined sources
Helixi119 – 12810Combined sources
Beta strandi130 – 1367Combined sources
Helixi158 – 16811Combined sources
Beta strandi174 – 1774Combined sources
Beta strandi188 – 1925Combined sources
Beta strandi197 – 1993Combined sources
Helixi201 – 2077Combined sources
Beta strandi211 – 2155Combined sources
Beta strandi218 – 2214Combined sources
Beta strandi224 – 2329Combined sources
Beta strandi235 – 2406Combined sources
Helixi253 – 2553Combined sources
Beta strandi256 – 2594Combined sources
Helixi260 – 2656Combined sources
Helixi280 – 2856Combined sources
Turni286 – 2883Combined sources
Helixi291 – 2933Combined sources
Helixi298 – 3014Combined sources
Helixi317 – 3237Combined sources
Turni324 – 3263Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1FGGX-ray2.30A/B76-335[»]
1KWSX-ray2.10A/B76-335[»]
3CU0X-ray1.90A/B76-335[»]
ProteinModelPortaliO94766.
SMRiO94766. Positions 76-335.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO94766.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni243 – 25210Interaction with galactose moiety of substrate glycoprotein

Sequence similaritiesi

Belongs to the glycosyltransferase 43 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG310844.
GeneTreeiENSGT00390000017640.
HOVERGENiHBG050650.
InParanoidiO94766.
KOiK10158.
OMAiPNAQFDS.
OrthoDBiEOG7QG44X.
PhylomeDBiO94766.
TreeFamiTF313522.

Family and domain databases

Gene3Di3.90.550.10. 1 hit.
InterProiIPR005027. Glyco_trans_43.
IPR029044. Nucleotide-diphossugar_trans.
[Graphical view]
PANTHERiPTHR10896. PTHR10896. 1 hit.
PfamiPF03360. Glyco_transf_43. 1 hit.
[Graphical view]
SUPFAMiSSF53448. SSF53448. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O94766-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLKLKNVFL AYFLVSIAGL LYALVQLGQP CDCLPPLRAA AEQLRQKDLR
60 70 80 90 100
ISQLQAELRR PPPAPAQPPE PEALPTIYVV TPTYARLVQK AELVRLSQTL
110 120 130 140 150
SLVPRLHWLL VEDAEGPTPL VSGLLAASGL LFTHLVVLTP KAQRLREGEP
160 170 180 190 200
GWVHPRGVEQ RNKALDWLRG RGGAVGGEKD PPPPGTQGVV YFADDDNTYS
210 220 230 240 250
RELFEEMRWT RGVSVWPVGL VGGLRFEGPQ VQDGRVVGFH TAWEPSRPFP
260 270 280 290 300
VDMAGFAVAL PLLLDKPNAQ FDSTAPRGHL ESSLLSHLVD PKDLEPRAAN
310 320 330
CTRVLVWHTR TEKPKMKQEE QLQRQGRGSD PAIEV
Length:335
Mass (Da):37,122
Last modified:April 26, 2004 - v2
Checksum:i5EC45408597F1C0F
GO
Isoform 2 (identifier: O94766-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-335: VLVWHTRTEKPKMKQEEQLQRQGRGSDPAIEV → TESRCVTQAGVQ

Note: No experimental confirmation available.

Show »
Length:315
Mass (Da):34,625
Checksum:iC0CE4A035B38E626
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti204 – 2041F → S in BAA34537. (PubMed:9506957)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti277 – 2771R → Q in JDSSDHD; reduced activity; patient fibroblasts have decreased levels of dermatan sulfate, chondroitin sulfate and heparan sulfate proteoglycans. 1 Publication
VAR_066624

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei304 – 33532VLVWH…PAIEV → TESRCVTQAGVQ in isoform 2. 1 PublicationVSP_056347Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009598 mRNA. Translation: BAA34537.1.
AK316228 mRNA. Translation: BAH14599.1.
AP001458 Genomic DNA. No translation available.
BC007906 mRNA. Translation: AAH07906.1.
BC071961 mRNA. Translation: AAH71961.1.
AJ005865 mRNA. Translation: CAA06742.1.
CCDSiCCDS8025.1. [O94766-1]
RefSeqiNP_001275652.1. NM_001288723.1. [O94766-2]
NP_036332.2. NM_012200.3. [O94766-1]
UniGeneiHs.502759.

Genome annotation databases

EnsembliENST00000265471; ENSP00000265471; ENSG00000149541. [O94766-1]
ENST00000534026; ENSP00000432474; ENSG00000149541. [O94766-2]
GeneIDi26229.
KEGGihsa:26229.
UCSCiuc001ntw.3. human. [O94766-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

GGDB

GlycoGene database

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009598 mRNA. Translation: BAA34537.1 .
AK316228 mRNA. Translation: BAH14599.1 .
AP001458 Genomic DNA. No translation available.
BC007906 mRNA. Translation: AAH07906.1 .
BC071961 mRNA. Translation: AAH71961.1 .
AJ005865 mRNA. Translation: CAA06742.1 .
CCDSi CCDS8025.1. [O94766-1 ]
RefSeqi NP_001275652.1. NM_001288723.1. [O94766-2 ]
NP_036332.2. NM_012200.3. [O94766-1 ]
UniGenei Hs.502759.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1FGG X-ray 2.30 A/B 76-335 [» ]
1KWS X-ray 2.10 A/B 76-335 [» ]
3CU0 X-ray 1.90 A/B 76-335 [» ]
ProteinModelPortali O94766.
SMRi O94766. Positions 76-335.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117620. 20 interactions.
IntActi O94766. 1 interaction.
STRINGi 9606.ENSP00000265471.

Protein family/group databases

CAZyi GT43. Glycosyltransferase Family 43.

PTM databases

PhosphoSitei O94766.

Proteomic databases

MaxQBi O94766.
PaxDbi O94766.
PRIDEi O94766.

Protocols and materials databases

DNASUi 26229.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265471 ; ENSP00000265471 ; ENSG00000149541 . [O94766-1 ]
ENST00000534026 ; ENSP00000432474 ; ENSG00000149541 . [O94766-2 ]
GeneIDi 26229.
KEGGi hsa:26229.
UCSCi uc001ntw.3. human. [O94766-1 ]

Organism-specific databases

CTDi 26229.
GeneCardsi GC11M062429.
HGNCi HGNC:923. B3GAT3.
HPAi HPA051328.
MIMi 245600. phenotype.
606374. gene.
neXtProti NX_O94766.
Orphaneti 284139. Larsen-like syndrome, B3GAT3 type.
PharmGKBi PA25217.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG310844.
GeneTreei ENSGT00390000017640.
HOVERGENi HBG050650.
InParanoidi O94766.
KOi K10158.
OMAi PNAQFDS.
OrthoDBi EOG7QG44X.
PhylomeDBi O94766.
TreeFami TF313522.

Enzyme and pathway databases

UniPathwayi UPA00378 .
BioCyci MetaCyc:HS07624-MONOMER.
Reactomei REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.

Miscellaneous databases

ChiTaRSi B3GAT3. human.
EvolutionaryTracei O94766.
GeneWikii B3GAT3.
GenomeRNAii 26229.
NextBioi 35480870.
PROi O94766.
SOURCEi Search...

Gene expression databases

Bgeei O94766.
CleanExi HS_B3GAT3.
ExpressionAtlasi O94766. baseline and differential.
Genevestigatori O94766.

Family and domain databases

Gene3Di 3.90.550.10. 1 hit.
InterProi IPR005027. Glyco_trans_43.
IPR029044. Nucleotide-diphossugar_trans.
[Graphical view ]
PANTHERi PTHR10896. PTHR10896. 1 hit.
Pfami PF03360. Glyco_transf_43. 1 hit.
[Graphical view ]
SUPFAMi SSF53448. SSF53448. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and expression of glucuronyltransferase I involved in the biosynthesis of the glycosaminoglycan-protein linkage region of proteoglycans."
    Kitagawa H., Tone Y., Tamura J., Neumann K.W., Ogawa T., Oka S., Kawasaki T., Sugahara K.
    J. Biol. Chem. 273:6615-6618(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
    Tissue: Placenta.
  2. "Structure/function of the human Ga1beta1,3-glucuronosyltransferase. Dimerization and functional activity are mediated by two crucial cysteine residues."
    Ouzzine M., Gulberti S., Netter P., Magdalou J., Fournel-Gigleux S.
    J. Biol. Chem. 275:28254-28260(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION, MUTAGENESIS.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Eye and Skin.
  6. "Three proteins involved in Caenorhabditis elegans vulval invagination are similar to components of a glycosylation pathway."
    Herman T., Horvitz H.R.
    Proc. Natl. Acad. Sci. U.S.A. 96:974-979(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 9-335 (ISOFORM 1).
    Tissue: Brain.
  7. "Characterization of recombinant human glucuronyltransferase I involved in the biosynthesis of the glycosaminoglycan-protein linkage region of proteoglycans."
    Tone Y., Kitagawa H., Imiya K., Oka S., Kawasaki T., Sugahara K.
    FEBS Lett. 459:415-420(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION.
  8. Cited for: SUBCELLULAR LOCATION, VARIANT JDSSDHD GLN-277, CHARACTERIZATION OF VARIANT JDSSDHD GLN-277.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Identification of phosphatase that dephosphorylates xylose in the glycosaminoglycan-protein linkage region of proteoglycans."
    Koike T., Izumikawa T., Sato B., Kitagawa H.
    J. Biol. Chem. 289:6695-6708(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH PXYLP1, MUTAGENESIS OF GLU-281.
  11. "Heparan/chondroitin sulfate biosynthesis. Structure and mechanism of human glucuronyltransferase I."
    Pedersen L.C., Tsuchida K., Kitagawa H., Sugahara K., Darden T.A., Negishi M.
    J. Biol. Chem. 275:34580-34585(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.30 ANGSTROMS) OF 76-335 IN COMPLEX WITH UDP-GLUCURONIC ACID AND GALACTOSE MOIETY OF SUBSTRATE GLYCOPROTEIN.
    Tissue: Liver.
  12. "Crystal structure of beta 1,3-glucuronyltransferase I in complex with active donor substrate UDP-GlcUA."
    Pedersen L.C., Darden T.A., Negishi M.
    J. Biol. Chem. 277:21869-21873(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 76-335 IN COMPLEX WITH UDP-GLUCURONIC ACID, ACTIVE SITE.
  13. "2-o-phosphorylation of xylose and 6-O-sulfation of galactose in the protein linkage region of glycosaminoglycans influence the glucuronyltransferase-I activity involved in the linkage region synthesis."
    Tone Y., Pedersen L.C., Yamamoto T., Izumikawa T., Kitagawa H., Nishihara J., Tamura J., Negishi M., Sugahara K.
    J. Biol. Chem. 283:16801-16807(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.90 ANGSTROMS) OF 76-335 IN COMPLEX WITH URIDINE-5'-DIPHOSPHATE AND GALACTOSE MOIETY OF SUBSTRATE GLYCOPROTEIN.

Entry informationi

Entry nameiB3GA3_HUMAN
AccessioniPrimary (citable) accession number: O94766
Secondary accession number(s): B7ZAB3, Q96I06, Q9UEP0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: April 26, 2004
Last modified: November 26, 2014
This is version 146 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3