O94763 (RMP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Unconventional prefoldin RPB5 interactor 1 Alternative name(s): Protein NNX3 Protein phosphatase 1 regulatory subunit 19 RNA polymerase II subunit 5-mediating protein Short name=RPB5-mediating protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 535 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in gene transcription regulation. Acts as a transcriptional repressor in concert with the corepressor UXT to regulate androgen receptor (AR) transcription. May act as a tumor suppressor to repress AR-mediated gene transcription and to inhibit anchorage-independent growth in prostate cancer cells. Required for cell survival in ovarian cancer cells. Together with UXT, associates with chromatin to the NKX3-1 promoter region. Antagonizes transcriptional modulation via hepatitis B virus X protein. Ref.6 Ref.7 Ref.8 Ref.9 Ref.12 Ref.13 Plays a central role in maintaining S6K1 signaling and BAD phosphorylation under normal growth conditions thereby protecting cells from potential deleterious effects of sustained S6K1 signaling. The URI1-PPP1CC complex acts as a central component of a negative feedback mechanism that counteracts excessive S6K1 survival signaling to BAD in response to growth factors. Mediates inhibition of PPP1CC phosphatase activity in mitochondria. Coordinates the regulation of nutrient-sensitive gene expression availability in a mTOR-dependent manner. Seems to be a scaffolding protein able to assemble a prefoldin-like complex that contains PFDs and proteins with roles in transcription and ubiquitination. Ref.6 Ref.7 Ref.8 Ref.9 Ref.12 Ref.13 |
| Subunit structure | Homodimer. Component of the URI complex that contains PFDN2, POLR2E/RPB5, RUVBL2, RUVBL1 and URI1. Interacts with PPP1CC; the interaction is phosphorylation-dependent and occurs in a growth factor-dependent manner. Interacts with PFDN2, PFDN4 and STAP1; the interactions are phosphorylation-dependent and occur in a growth-dependent manner in the mitochondrion. Interacts (via the middle C-terminus region) with GTF2F1 and GTF2F2. Interacts with DMAP1, POLR2E/RPB5 and UXT. Ref.2 Ref.6 Ref.7 Ref.8 Ref.12 Ref.13 |
| Subcellular location | Nucleus. Cytoplasm. Mitochondrion. Cell projection › dendrite By similarity. Note: Colocalizes with PFDN2, PFDN4, PPP1CC, RPS6KB1 and STAP1 at mitochondrion. Ref.1 Ref.8 Ref.9 |
| Tissue specificity | Ubiquitous. Expressed in ovarian cancers (at protein level). Expressed strongly in skeletal muscle. Expressed weakly in brain, heart, pancreas and in prostate epithelial cells. Ref.1 Ref.2 Ref.12 Ref.13 |
| Post-translational modification | Phosphorylated. Phosphorylation occurs essentially on serine residues. Phosphorylation occurs in response to androgen treatment in prostate cancer cells in a mTOR-dependent manner. Phosphorylated; hyperhosphorylated in mitochondria in a mTORC-dependent signaling pathway. Phosphorylated at Ser-372 by RPS6KB1 in a growth factor- and rapamycin-dependent manner. S6K1-mediated mitochondrial phosphorylation at Ser-372 disrupts the URI1-PPP1CC complex in the mitochondrion, relieves PPP1CC phosphatase inhibition activity and hence engages a negative feedback diminishing RPS6KB1 kinase activity, preventing sustained S6K1-dependent signaling. Ref.1 Ref.9 Ref.12 Ref.13 |
| Sequence similarities | Belongs to the RNA polymerase II subunit 5-mediating protein family. |
| Sequence caution | The sequence AAH26184.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GTF2F1 | P35269 | 3 | EBI-357067,EBI-457886 | |
| GTF2F2 | P13984 | 4 | EBI-357067,EBI-1030560 | |
| POLR2E | P19388 | 2 | EBI-357067,EBI-395189 | |
| PPP1CC | P36873 | 5 | EBI-357067,EBI-356283 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94763-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94763-2) The sequence of this isoform differs from the canonical sequence as follows: 1-76: Missing. | ||||||
| Isoform 3 (identifier: O94763-3) The sequence of this isoform differs from the canonical sequence as follows: 1-51: MEAPTVETPP...TNCQERIQHW → MRLGNVDFTLGSNVPCVYLVFSVNR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O94763-4) The sequence of this isoform differs from the canonical sequence as follows: 1-39: MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEK → MTTWSSLQGSHVSKRALAYAL 476-535: AFSGTVIEKE...FKAARLQQKD → VLRLVGYSRNLAPLNVIL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 535 | 535 | Unconventional prefoldin RPB5 interactor 1 | PRO_0000097365 | |||||
Regions | |||||||||
| Compositional bias | 299 – 311 | 13 | Poly-Asp | ||||||
| Compositional bias | 314 – 321 | 8 | Poly-Asp | ||||||
Amino acid modifications | |||||||||
| Modified residue | 244 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 372 | 1 | Phosphoserine; by RPS6KB1 Ref.9 Ref.10 Ref.12 | ||||||
| Modified residue | 440 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 76 | 76 | Missing in isoform 2. | VSP_032773 | |||||
| Alternative sequence | 1 – 51 | 51 | MEAPT…RIQHW → MRLGNVDFTLGSNVPCVYLV FSVNR in isoform 3. | VSP_042259 | |||||
| Alternative sequence | 1 – 39 | 39 | MEAPT…EEQEK → MTTWSSLQGSHVSKRALAYA L in isoform 4. | VSP_044769 | |||||
| Alternative sequence | 476 – 535 | 60 | AFSGT…LQQKD → VLRLVGYSRNLAPLNVIL in isoform 4. | VSP_044770 | |||||
| Natural variant | 22 | 1 | L → P. Corresponds to variant rs189187 [ dbSNP | Ensembl ]. | VAR_056978 | |||||
Experimental info | |||||||||
| Mutagenesis | 372 | 1 | S → A: Does not lead to dissociation of the URI1-PPP1CC complex. Enhances phosphorylation of RPS6KB1 after IGF1 stimulation. Confers a cell survival increase. Ref.9 Ref.12 | ||||||
| Sequence conflict | 7 | 1 | E → G in BAF84859. Ref.3 | ||||||
| Sequence conflict | 232 | 1 | D → N in AAH26184. Ref.5 | ||||||
| Sequence conflict | 311 | 1 | Missing in AAD08679. Ref.1 | ||||||
| Sequence conflict | 311 | 1 | Missing in BAA34781. Ref.2 | ||||||
| Sequence conflict | 311 | 1 | Missing in BAF84859. Ref.3 | ||||||
| Sequence conflict | 311 | 1 | Missing in AAH26184. Ref.5 | ||||||
| Sequence conflict | 315 | 1 | D → E in BAF84859. Ref.3 | ||||||
| Sequence conflict | 434 | 1 | R → G in BAA34781. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of a gene on chromosome 19q12 coding for a novel intracellular protein: analysis of expression in human and mouse tissues and in human tumor cells, particularly Reed-Sternberg cells in Hodgkin disease." Van Leuven F., Torrekens S., Moechars D., Hilliker C., Buellens M., Bollen M., Delabie J. Genomics 54:511-520(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PHOSPHORYLATION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Liver. |
| [2] | "RMP, a novel RNA polymerase II subunit 5-interacting protein, counteracts transactivation by hepatitis B virus X protein." Dorjsuren D., Lin Y., Wei W., Yamashita T., Nomura T., Hayashi N., Murakami S. Mol. Cell. Biol. 18:7546-7555(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INTERACTION WITH POLR2E, TISSUE SPECIFICITY. Tissue: Hepatoma. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Testis. |
| [6] | "Interaction with general transcription factor IIF (TFIIF) is required for the suppression of activated transcription by RPB5-mediating protein (RMP)." Wei W., Gu J.X., Zhu C.Q., Sun F.Y., Dorjsuren D., Lin Y., Murakami S. Cell Res. 13:111-120(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN TRANSCRIPTIONAL REGULATION, INTERACTION WITH GTF2F1 AND GTF2F2. |
| [7] | "Control of nutrient-sensitive transcription programs by the unconventional prefoldin URI." Gstaiger M., Luke B., Hess D., Oakeley E.J., Wirbelauer C., Blondel M., Vigneron M., Peter M., Krek W. Science 302:1208-1212(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE URI COMPLEX. |
| [8] | "Subcellular localization of RPB5-mediating protein and its putative functional partner." Delgermaa L., Hayashi N., Dorjsuren D., Nomura T., Thuy le T.T., Murakami S. Mol. Cell. Biol. 24:8556-8566(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH DMAP1, SUBCELLULAR LOCATION. |
| [9] | "S6K1-mediated disassembly of mitochondrial URI/PP1gamma complexes activates a negative feedback program that counters S6K1 survival signaling." Djouder N., Metzler S.C., Schmidt A., Wirbelauer C., Gstaiger M., Aebersold R., Hess D., Krek W. Mol. Cell 28:28-40(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN DEPHOSPHORYLATION OF PPP1CC, PHOSPHORYLATION AT SER-372 BY RPS6KB1, MUTAGENESIS OF SER-372, SUBCELLULAR LOCATION, IDENTIFICATION BY SPECTROMETRY. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-372, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [12] | "URI is an oncogene amplified in ovarian cancer cells and is required for their survival." Theurillat J.P., Metzler S.C., Henzi N., Djouder N., Helbling M., Zimmermann A.K., Jacob F., Soltermann A., Caduff R., Heinzelmann-Schwarz V., Moch H., Krek W. Cancer Cell 19:317-332(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH PPP1CC, PHOSPHORYLATION AT SER-372, MUTAGENESIS OF SER-372, TISSUE SPECIFICITY. |
| [13] | "Regulation of androgen receptor-mediated transcription by RPB5 binding protein URI/RMP." Mita P., Savas J.N., Djouder N., Yates J.R. III, Ha S., Ruoff R., Schafler E.D., Nwachukwu J.C., Tanese N., Cowan N.J., Zavadil J., Garabedian M.J., Logan S.K. Mol. Cell. Biol. 31:3639-3652(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN TRANSCRIPTIONAL REGULATION, INTERACTION WITH UXT, PHOSPHORYLATION, TISSUE SPECIFICITY. |
| [14] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF091095 mRNA. Translation: AAD08679.1. AB006572 mRNA. Translation: BAA34781.1. AK292170 mRNA. Translation: BAF84859.1. AC008507 mRNA. No translation available. BC026184 mRNA. Translation: AAH26184.2. Different initiation. |
| IPI | IPI00477619. IPI00939535. IPI01015668. |
| RefSeq | NP_001239570.1. NM_001252641.1. NP_003787.2. NM_003796.3. |
| UniGene | Hs.466391. |
3D structure databases | |
| ProteinModelPortal | O94763. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O94763. 19 interactions. |
| MINT | MINT-1154170. |
| STRING | 9606.ENSP00000376097. |
PTM databases | |
| PhosphoSite | O94763. |
Proteomic databases | |
| PaxDb | O94763. |
| PRIDE | O94763. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000360605; ENSP00000353817; ENSG00000105176. ENST00000392271; ENSP00000376097; ENSG00000105176. ENST00000542441; ENSP00000442436; ENSG00000105176. |
| GeneID | 8725. |
| KEGG | hsa:8725. |
| UCSC | uc002nsq.3. human. |
Organism-specific databases | |
| CTD | 8725. |
| GeneCards | GC19P030415. |
| H-InvDB | HIX0014980. |
| HGNC | HGNC:13236. URI1. |
| MIM | 603494. gene. |
| neXtProt | NX_O94763. |
| PharmGKB | PA134962614. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG331327. |
| HOGENOM | HOG000154150. |
| HOVERGEN | HBG007610. |
| InParanoid | O94763. |
| OMA | IPRKSIL. |
| PhylomeDB | O94763. |
Gene expression databases | |
| ArrayExpress | O94763. |
| Bgee | O94763. |
| CleanEx | HS_C19orf2. |
| Genevestigator | O94763. |
| GermOnline | ENSG00000105176. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR009053. Prefoldin. IPR004127. Prefoldin_subunit. [Graphical view] |
| Pfam | PF02996. Prefoldin. 1 hit. [Graphical view] |
| SUPFAM | SSF46579. Prefoldin. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | URI1. human. |
| GenomeRNAi | 8725. |
| NextBio | 32727. |
| SOURCE | Search... |
Entry information
| Entry name | RMP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94763 Secondary accession number(s): A8K805 Q9UNU3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
