Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transient receptor potential cation channel subfamily M member 2

Gene

TRPM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Isoform 1: Nonselective, voltage-independent cation channel that mediates Na+ and Ca2+ influx, leading to increased cytoplasmic Ca2+ levels (PubMed:11960981, PubMed:12594222, PubMed:11385575, PubMed:11509734, PubMed:11804595, PubMed:15561722, PubMed:16601673, PubMed:19171771, PubMed:20660597, PubMed:27383051, PubMed:27068538). Extracellular calcium passes through the channel and increases channel activity by binding to the cytoplasmic domain and stabilizing the channel in an open conformation (PubMed:19171771). Also contributes to Ca2+ release from intracellular stores in response to ADP-ribose (PubMed:19454650). Plays a role in numerous processes that involve signaling via intracellular Ca2+ levels (Probable). Besides, mediates the release of lysosomal Zn2+ stores in response to reactive oxygen species, leading to increased cytosolic Zn2+ levels (PubMed:25562606, PubMed:27068538). Activated by moderate heat (35 to 40 degrees Celsius) (PubMed:16601673). Activated by intracellular ADP-ribose, beta-NAD (NAD+) and similar compounds, and by oxidative stress caused by reactive oxygen or nitrogen species (PubMed:11960981, PubMed:11385575, PubMed:11509734, PubMed:11804595, PubMed:15561722, PubMed:16601673, PubMed:19171771, PubMed:27383051, PubMed:27068538). The precise physiological activators are under debate; the true, physiological activators may be ADP-ribose and ADP-ribose-2'-phosphate (PubMed:20650899, PubMed:25918360). Activation by ADP-ribose and beta-NAD is strongly increased by moderate heat (35 to 40 degrees Celsius) (PubMed:16601673). Likewise, reactive oxygen species lower the threshold for activation by moderate heat (37 degrees Celsius) (PubMed:22493272). Plays a role in mediating behavorial and physiological responses to moderate heat and thereby contributes to body temperature homeostasis. Plays a role in insulin secretion, a process that requires increased cytoplasmic Ca2+ levels (By similarity). Required for normal IFNG and cytokine secretion and normal innate immune immunity in response to bacterial infection. Required for normal phagocytosis and cytokine release by macrophages exposed to zymosan (in vitro). Plays a role in dendritic cell differentiation and maturation, and in dendritic cell chemotaxis via its role in regulating cytoplasmic Ca2+ levels (By similarity). Plays a role in the regulation of the reorganization of the actin cytoskeleton and filopodia formation in response to reactive oxygen species via its role in increasing cytoplasmic Ca2+ and Zn2+ levels (PubMed:27068538). Confers susceptibility to cell death following oxidative stress (PubMed:12594222, PubMed:25562606).By similarityCurated16 Publications
Isoform 2: Lacks cation channel activity. Does not mediate cation transport in response to oxidative stress or ADP-ribose.1 Publication
Isoform 3: Lacks cation channel activity and negatively regulates the channel activity of isoform 1. Negatively regulates susceptibility to cell death in reposponse to oxidative stress.1 Publication

Enzyme regulationi

Inactivated by exposure to extracellular pH between 4.0 and 6.5; irreversibly inactivated when open channels are exposed to extracellular pH between 4.0 and 6.5, while pre-exposure of closed channels to extracellular pH 5.5 gives rise to currents that rapidly inactivate, but protects against irreversible inactivation (PubMed:20660597). Inactivated by intracellular ATP (PubMed:11509734). Activated by arachidonic acid (PubMed:11804595).3 Publications

GO - Molecular functioni

  • calcium channel activity Source: Reactome
  • calcium ion binding Source: UniProtKB
  • calcium-release channel activity Source: UniProtKB
  • cation channel activity Source: UniProtKB
  • ligand-gated calcium channel activity Source: UniProtKB
  • sodium channel activity Source: UniProtKB-KW

GO - Biological processi

  • calcium ion import across plasma membrane Source: UniProtKB
  • calcium ion transmembrane import into cytosol Source: UniProtKB
  • calcium ion transmembrane transport Source: Reactome
  • calcium ion transport Source: ProtInc
  • calcium-mediated signaling using intracellular calcium source Source: UniProtKB
  • cellular response to calcium ion Source: UniProtKB
  • cellular response to hydrogen peroxide Source: UniProtKB
  • cellular response to purine-containing compound Source: UniProtKB
  • cellular response to temperature stimulus Source: UniProtKB
  • dendritic cell chemotaxis Source: UniProtKB
  • dendritic cell differentiation Source: UniProtKB
  • estrous cycle Source: Ensembl
  • positive regulation of insulin secretion Source: Ensembl
  • positive regulation of oxidative stress-induced neuron death Source: Ensembl
  • regulation of actin cytoskeleton reorganization Source: UniProtKB
  • regulation of filopodium assembly Source: UniProtKB
  • release of sequestered calcium ion into cytosol Source: UniProtKB
  • response to purine-containing compound Source: UniProtKB
  • temperature homeostasis Source: UniProtKB
  • zinc II ion transmembrane transport Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Sodium channel

Keywords - Biological processi

Calcium transport, Ion transport, Sodium transport, Transport

Keywords - Ligandi

Calcium, Sodium

Enzyme and pathway databases

BioCyciZFISH:HS06903-MONOMER.
ReactomeiR-HSA-3295583. TRP channels.
R-HSA-6798695. Neutrophil degranulation.

Protein family/group databases

TCDBi1.A.4.5.5. the transient receptor potential ca(2+) channel (trp-cc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Transient receptor potential cation channel subfamily M member 2
Alternative name(s):
Estrogen-responsive element-associated gene 1 protein1 Publication
Long transient receptor potential channel 21 Publication
Short name:
LTrpC-2
Short name:
LTrpC21 Publication
Transient receptor potential channel 71 Publication
Short name:
TrpC71 Publication
Transient receptor potential melastatin 21 Publication
Gene namesi
Name:TRPM2
Synonyms:EREG11 Publication, KNP3, LTRPC21 Publication, TRPC71 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 21

Organism-specific databases

HGNCiHGNC:12339. TRPM2.

Subcellular locationi

Isoform 1 :
Isoform 2 :
Isoform 3 :

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 752CytoplasmicSequence analysisAdd BLAST752
Transmembranei753 – 773HelicalSequence analysisAdd BLAST21
Topological domaini774 – 795ExtracellularSequence analysisAdd BLAST22
Transmembranei796 – 816HelicalSequence analysisAdd BLAST21
Topological domaini817 – 872CytoplasmicSequence analysisAdd BLAST56
Transmembranei873 – 893HelicalSequence analysisAdd BLAST21
Topological domaini894 – 896ExtracellularSequence analysis3
Transmembranei897 – 917HelicalSequence analysisAdd BLAST21
Topological domaini918 – 936CytoplasmicSequence analysisAdd BLAST19
Transmembranei937 – 957HelicalSequence analysisAdd BLAST21
Topological domaini958 – 1025ExtracellularSequence analysisAdd BLAST68
Transmembranei1026 – 1046HelicalSequence analysisAdd BLAST21
Topological domaini1047 – 1503CytoplasmicSequence analysisAdd BLAST457

GO - Cellular componenti

  • cytoplasmic vesicle membrane Source: UniProtKB
  • integral component of plasma membrane Source: UniProtKB
  • lysosomal membrane Source: UniProtKB
  • lysosome Source: UniProtKB
  • neuron projection Source: Ensembl
  • perikaryon Source: UniProtKB-SubCell
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasmic vesicle, Lysosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi215M → A: Abolishes lowering of temperature threshold for activation in response to reactive oxygen species. 1 Publication1
Mutagenesisi952K → A: Strongly reduces channel activity at ph 7.3. Increased residual channel activity after exposure to pH 5.5. 1 Publication1
Mutagenesisi958H → A: No effect on channel activity. 1 Publication1
Mutagenesisi961R → A: Mildly decreases channel activity. 1 Publication1
Mutagenesisi962R → A: Abolishes channel activity. 1 Publication1
Mutagenesisi968R → A: Abolishes channel activity. 1 Publication1
Mutagenesisi973H → A: No effect on channel activity. 1 Publication1
Mutagenesisi995H → A: Moderately decreases channel activity. 1 Publication1
Mutagenesisi1002D → A: Strongly increased residual channel activity after exposure to pH 5.5. 1 Publication1
Mutagenesisi1005K → A: Decreases channel activity. 1 Publication1
Mutagenesisi1007K → A: Nearly abolishes channel activity. 1 Publication1
Mutagenesisi1397M → I: Only slight effect on activity. 1 Publication1
Mutagenesisi1404R → Q: Abolishes channel activity. 1 Publication1
Mutagenesisi1405 – 1408ILRQ → EFRE: Decreased channel activity in response to ADP-ribose. 1 Publication4
Mutagenesisi1408 – 1409QE → KK: Expected to abolish the initially proposed hydrolase activity. Does not abolish channel activity in response to ADP-ribose. 1 Publication2
Mutagenesisi1408Q → E: Decreased channel activity. 1 Publication1

Organism-specific databases

DisGeNETi7226.
OpenTargetsiENSG00000142185.
PharmGKBiPA37012.

Chemistry databases

ChEMBLiCHEMBL1250402.
GuidetoPHARMACOLOGYi494.

Polymorphism and mutation databases

BioMutaiTRPM2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002153261 – 1503Transient receptor potential cation channel subfamily M member 2Add BLAST1503

Proteomic databases

PaxDbiO94759.
PeptideAtlasiO94759.
PRIDEiO94759.

PTM databases

iPTMnetiO94759.
PhosphoSitePlusiO94759.

Expressioni

Tissue specificityi

Highly expressed in brain and peripheral blood cells, such as neutrophils. Also detected in bone marrow, spleen, heart, liver and lung. Isoform 2 is found in neutrophil granulocytes.2 Publications

Gene expression databases

BgeeiENSG00000142185.
CleanExiHS_TRPC7.
HS_TRPM2.
ExpressionAtlasiO94759. baseline and differential.
GenevisibleiO94759. HS.

Organism-specific databases

HPAiHPA030976.
HPA035260.

Interactioni

Subunit structurei

Isoform 1 can interact with isoform 3. This interaction decreases calcium influx through isoform 1 and suppresses susceptibility to oxidative stress-induced cell death.1 Publication

Protein-protein interaction databases

STRINGi9606.ENSP00000300482.

Chemistry databases

BindingDBiO94759.

Structurei

3D structure databases

ProteinModelPortaliO94759.
SMRiO94759.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1354 – 1498Nudix hydrolasePROSITE-ProRule annotationAdd BLAST145

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi1390 – 1411Nudix boxPROSITE-ProRule annotationAdd BLAST22

Domaini

The cytosolic nudix box binds ADP-ribose and is required for channel activation by ADP-ribose (PubMed:15561722, PubMed:16601673).2 Publications

Sequence similaritiesi

Contains 1 nudix hydrolase domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3614. Eukaryota.
KOG4195. Eukaryota.
ENOG410XR5B. LUCA.
GeneTreeiENSGT00760000119127.
HOGENOMiHOG000236350.
HOVERGENiHBG055825.
InParanoidiO94759.
KOiK04977.
PhylomeDBiO94759.
TreeFamiTF314204.

Family and domain databases

Gene3Di3.90.79.10. 1 hit.
InterProiIPR005821. Ion_trans_dom.
IPR000086. NUDIX_hydrolase_dom.
IPR015797. NUDIX_hydrolase_dom-like.
IPR029594. TRPM2.
[Graphical view]
PANTHERiPTHR13800:SF2. PTHR13800:SF2. 1 hit.
PfamiPF00520. Ion_trans. 1 hit.
[Graphical view]
SUPFAMiSSF55811. SSF55811. 1 hit.
PROSITEiPS51462. NUDIX. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O94759-1) [UniParc]FASTAAdd to basket
Also known as: TRPM2-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPSALRKAG SEQEEGFEGL PRRVTDLGMV SNLRRSNSSL FKSWRLQCPF
60 70 80 90 100
GNNDKQESLS SWIPENIKKK ECVYFVESSK LSDAGKVVCQ CGYTHEQHLE
110 120 130 140 150
EATKPHTFQG TQWDPKKHVQ EMPTDAFGDI VFTGLSQKVK KYVRVSQDTP
160 170 180 190 200
SSVIYHLMTQ HWGLDVPNLL ISVTGGAKNF NMKPRLKSIF RRGLVKVAQT
210 220 230 240 250
TGAWIITGGS HTGVMKQVGE AVRDFSLSSS YKEGELITIG VATWGTVHRR
260 270 280 290 300
EGLIHPTGSF PAEYILDEDG QGNLTCLDSN HSHFILVDDG THGQYGVEIP
310 320 330 340 350
LRTRLEKFIS EQTKERGGVA IKIPIVCVVL EGGPGTLHTI DNATTNGTPC
360 370 380 390 400
VVVEGSGRVA DVIAQVANLP VSDITISLIQ QKLSVFFQEM FETFTESRIV
410 420 430 440 450
EWTKKIQDIV RRRQLLTVFR EGKDGQQDVD VAILQALLKA SRSQDHFGHE
460 470 480 490 500
NWDHQLKLAV AWNRVDIARS EIFMDEWQWK PSDLHPTMTA ALISNKPEFV
510 520 530 540 550
KLFLENGVQL KEFVTWDTLL YLYENLDPSC LFHSKLQKVL VEDPERPACA
560 570 580 590 600
PAAPRLQMHH VAQVLRELLG DFTQPLYPRP RHNDRLRLLL PVPHVKLNVQ
610 620 630 640 650
GVSLRSLYKR SSGHVTFTMD PIRDLLIWAI VQNRRELAGI IWAQSQDCIA
660 670 680 690 700
AALACSKILK ELSKEEEDTD SSEEMLALAE EYEHRAIGVF TECYRKDEER
710 720 730 740 750
AQKLLTRVSE AWGKTTCLQL ALEAKDMKFV SHGGIQAFLT KVWWGQLSVD
760 770 780 790 800
NGLWRVTLCM LAFPLLLTGL ISFREKRLQD VGTPAARARA FFTAPVVVFH
810 820 830 840 850
LNILSYFAFL CLFAYVLMVD FQPVPSWCEC AIYLWLFSLV CEEMRQLFYD
860 870 880 890 900
PDECGLMKKA ALYFSDFWNK LDVGAILLFV AGLTCRLIPA TLYPGRVILS
910 920 930 940 950
LDFILFCLRL MHIFTISKTL GPKIIIVKRM MKDVFFFLFL LAVWVVSFGV
960 970 980 990 1000
AKQAILIHNE RRVDWLFRGA VYHSYLTIFG QIPGYIDGVN FNPEHCSPNG
1010 1020 1030 1040 1050
TDPYKPKCPE SDATQQRPAF PEWLTVLLLC LYLLFTNILL LNLLIAMFNY
1060 1070 1080 1090 1100
TFQQVQEHTD QIWKFQRHDL IEEYHGRPAA PPPFILLSHL QLFIKRVVLK
1110 1120 1130 1140 1150
TPAKRHKQLK NKLEKNEEAA LLSWEIYLKE NYLQNRQFQQ KQRPEQKIED
1160 1170 1180 1190 1200
ISNKVDAMVD LLDLDPLKRS GSMEQRLASL EEQVAQTAQA LHWIVRTLRA
1210 1220 1230 1240 1250
SGFSSEADVP TLASQKAAEE PDAEPGGRKK TEEPGDSYHV NARHLLYPNC
1260 1270 1280 1290 1300
PVTRFPVPNE KVPWETEFLI YDPPFYTAER KDAAAMDPMG DTLEPLSTIQ
1310 1320 1330 1340 1350
YNVVDGLRDR RSFHGPYTVQ AGLPLNPMGR TGLRGRGSLS CFGPNHTLYP
1360 1370 1380 1390 1400
MVTRWRRNED GAICRKSIKK MLEVLVVKLP LSEHWALPGG SREPGEMLPR
1410 1420 1430 1440 1450
KLKRILRQEH WPSFENLLKC GMEVYKGYMD DPRNTDNAWI ETVAVSVHFQ
1460 1470 1480 1490 1500
DQNDVELNRL NSNLHACDSG ASIRWQVVDR RIPLYANHKT LLQKAAAEFG

AHY
Length:1,503
Mass (Da):171,198
Last modified:October 23, 2007 - v2
Checksum:i02338437501ABFAB
GO
Isoform 2 (identifier: O94759-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     538-557: Missing.
     1291-1325: DTLEPLSTIQYNVVDGLRDRRSFHGPYTVQAGLPL → E

Show »
Length:1,449
Mass (Da):165,273
Checksum:iCFFA7E256DABB60B
GO
Isoform 3 (identifier: O94759-3) [UniParc]FASTAAdd to basket
Also known as: TRPM2-S

The sequence of this isoform differs from the canonical sequence as follows:
     847-1503: Missing.

Show »
Length:846
Mass (Da):95,699
Checksum:i70B0B29CADE26939
GO

Sequence cautioni

The sequence BAB64300 differs from that shown. Reason: Frameshift at positions 1227 and 1237.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1088S → N in CAD01139 (PubMed:11960981).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02521652N → K.1 PublicationCorresponds to variant rs45625933dbSNPEnsembl.1
Natural variantiVAR_025217166V → I.1 PublicationCorresponds to variant rs45544142dbSNPEnsembl.1
Natural variantiVAR_025218385V → M.1 PublicationCorresponds to variant rs45485992dbSNPEnsembl.1
Natural variantiVAR_020032543D → E.1 PublicationCorresponds to variant rs1556314dbSNPEnsembl.1
Natural variantiVAR_025219780D → E.1 PublicationCorresponds to variant rs9974927dbSNPEnsembl.1
Natural variantiVAR_0252201189Q → R.5 PublicationsCorresponds to variant rs9978351dbSNPEnsembl.1
Natural variantiVAR_0252211199R → W.1 PublicationCorresponds to variant rs45611537dbSNPEnsembl.1
Natural variantiVAR_0252221201S → G.1 PublicationCorresponds to variant rs45519835dbSNPEnsembl.1
Natural variantiVAR_0252231249N → S.1 PublicationCorresponds to variant rs45513700dbSNPEnsembl.1
Natural variantiVAR_0252241347T → M.1 PublicationCorresponds to variant rs45589233dbSNPEnsembl.1
Natural variantiVAR_0252251359E → K.1 PublicationCorresponds to variant rs45570639dbSNPEnsembl.1
Natural variantiVAR_0252261368I → M.1 PublicationCorresponds to variant rs45613636dbSNPEnsembl.1
Natural variantiVAR_0252271438A → S.1 PublicationCorresponds to variant rs45578242dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006574538 – 557Missing in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_013018847 – 1503Missing in isoform 3. 1 PublicationAdd BLAST657
Alternative sequenceiVSP_0065751291 – 1325DTLEP…AGLPL → E in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB001535 mRNA. Translation: BAA34700.1.
AJ417076 mRNA. Translation: CAD01139.1.
AY603182 mRNA. Translation: AAT12288.1.
AB166745 mRNA. Translation: BAD83705.1.
AJ878416 mRNA. Translation: CAI47593.1.
DQ012935 Genomic DNA. Translation: AAY22174.1.
AP001754 Genomic DNA. Translation: BAA95563.1.
CH471079 Genomic DNA. Translation: EAX09426.1.
CH471079 Genomic DNA. Translation: EAX09427.1.
AB017549 mRNA. Translation: BAB64300.1. Frameshift.
CCDSiCCDS13710.1. [O94759-1]
RefSeqiNP_001307279.1. NM_001320350.1.
NP_001307280.1. NM_001320351.1.
NP_003298.1. NM_003307.3.
XP_005261228.1. XM_005261171.3. [O94759-1]
UniGeneiHs.369759.

Genome annotation databases

EnsembliENST00000300481; ENSP00000300481; ENSG00000142185. [O94759-2]
ENST00000300482; ENSP00000300482; ENSG00000142185. [O94759-1]
ENST00000397928; ENSP00000381023; ENSG00000142185. [O94759-1]
GeneIDi7226.
KEGGihsa:7226.
UCSCiuc002zet.1. human. [O94759-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB001535 mRNA. Translation: BAA34700.1.
AJ417076 mRNA. Translation: CAD01139.1.
AY603182 mRNA. Translation: AAT12288.1.
AB166745 mRNA. Translation: BAD83705.1.
AJ878416 mRNA. Translation: CAI47593.1.
DQ012935 Genomic DNA. Translation: AAY22174.1.
AP001754 Genomic DNA. Translation: BAA95563.1.
CH471079 Genomic DNA. Translation: EAX09426.1.
CH471079 Genomic DNA. Translation: EAX09427.1.
AB017549 mRNA. Translation: BAB64300.1. Frameshift.
CCDSiCCDS13710.1. [O94759-1]
RefSeqiNP_001307279.1. NM_001320350.1.
NP_001307280.1. NM_001320351.1.
NP_003298.1. NM_003307.3.
XP_005261228.1. XM_005261171.3. [O94759-1]
UniGeneiHs.369759.

3D structure databases

ProteinModelPortaliO94759.
SMRiO94759.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000300482.

Chemistry databases

BindingDBiO94759.
ChEMBLiCHEMBL1250402.
GuidetoPHARMACOLOGYi494.

Protein family/group databases

TCDBi1.A.4.5.5. the transient receptor potential ca(2+) channel (trp-cc) family.

PTM databases

iPTMnetiO94759.
PhosphoSitePlusiO94759.

Polymorphism and mutation databases

BioMutaiTRPM2.

Proteomic databases

PaxDbiO94759.
PeptideAtlasiO94759.
PRIDEiO94759.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300481; ENSP00000300481; ENSG00000142185. [O94759-2]
ENST00000300482; ENSP00000300482; ENSG00000142185. [O94759-1]
ENST00000397928; ENSP00000381023; ENSG00000142185. [O94759-1]
GeneIDi7226.
KEGGihsa:7226.
UCSCiuc002zet.1. human. [O94759-1]

Organism-specific databases

CTDi7226.
DisGeNETi7226.
GeneCardsiTRPM2.
HGNCiHGNC:12339. TRPM2.
HPAiHPA030976.
HPA035260.
MIMi603749. gene.
neXtProtiNX_O94759.
OpenTargetsiENSG00000142185.
PharmGKBiPA37012.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3614. Eukaryota.
KOG4195. Eukaryota.
ENOG410XR5B. LUCA.
GeneTreeiENSGT00760000119127.
HOGENOMiHOG000236350.
HOVERGENiHBG055825.
InParanoidiO94759.
KOiK04977.
PhylomeDBiO94759.
TreeFamiTF314204.

Enzyme and pathway databases

BioCyciZFISH:HS06903-MONOMER.
ReactomeiR-HSA-3295583. TRP channels.
R-HSA-6798695. Neutrophil degranulation.

Miscellaneous databases

GeneWikiiTRPM2.
GenomeRNAii7226.
PROiO94759.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000142185.
CleanExiHS_TRPC7.
HS_TRPM2.
ExpressionAtlasiO94759. baseline and differential.
GenevisibleiO94759. HS.

Family and domain databases

Gene3Di3.90.79.10. 1 hit.
InterProiIPR005821. Ion_trans_dom.
IPR000086. NUDIX_hydrolase_dom.
IPR015797. NUDIX_hydrolase_dom-like.
IPR029594. TRPM2.
[Graphical view]
PANTHERiPTHR13800:SF2. PTHR13800:SF2. 1 hit.
PfamiPF00520. Ion_trans. 1 hit.
[Graphical view]
SUPFAMiSSF55811. SSF55811. 1 hit.
PROSITEiPS51462. NUDIX. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTRPM2_HUMAN
AccessioniPrimary (citable) accession number: O94759
Secondary accession number(s): D3DSL6
, Q5KTC2, Q6J3P5, Q96KN6, Q96Q93
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 23, 2007
Last modified: November 30, 2016
This is version 160 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

The isolated nudix hydrolase domain was shown to have low catalytic activity with ADP-ribose upon heterologous expression (PubMed:11385575). However, a more recent publication demonstrates that the nudix hydrolase domain lacks enzyme activity and suggests that spontaneous degradation of the substrate underlies the previously reported low activity (PubMed:27383051).2 Publications

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.