SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O94759

- TRPM2_HUMAN

UniProt

O94759 - TRPM2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transient receptor potential cation channel subfamily M member 2

Gene
TRPM2, EREG1, KNP3, LTRPC2, TRPC7
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Nonselective, voltage-independent cation channel mediating sodium and calcium ion influx in response to oxidative stress. Extracellular calcium passes through the channel and acts from the intracellular side as a positive regulator in channel activation. Activated by ADP-ribose, nicotinamide adenine dinucleotide (NAD+), reactive nitrogen species and arachidonic acid. Inactivated by intracellular ATP. Confers susceptibility to cell death following oxidative stress. Isoform 2 does not seem to be regulated by ADPR. Has ADP-ribose pyrophosphatase activity.1 Publication

Catalytic activityi

ADP-D-ribose + H2O = AMP + D-ribose 5-phosphate.1 Publication

Kineticsi

  1. KM=100 µM for ADP-ribose

Vmax=0.1 µmol/min/mg enzyme

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi1390 – 141223NADAdd
BLAST

GO - Molecular functioni

  1. ADP-ribose diphosphatase activity Source: UniProtKB-EC
  2. calcium channel activity Source: ProtInc
  3. manganese ion transmembrane transporter activity Source: Ensembl
  4. sodium channel activity Source: UniProtKB-KW

GO - Biological processi

  1. calcium ion transmembrane transport Source: Reactome
  2. calcium ion transport Source: ProtInc
  3. ion transmembrane transport Source: Reactome
  4. response to hydroperoxide Source: Ensembl
  5. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Hydrolase, Ion channel, Sodium channel

Keywords - Biological processi

Calcium transport, Ion transport, Sodium transport, Transport

Keywords - Ligandi

Calcium, NAD, Sodium

Enzyme and pathway databases

ReactomeiREACT_169333. TRP channels.

Protein family/group databases

TCDBi1.A.4.5.5. the transient receptor potential ca(2+) channel (trp-cc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Transient receptor potential cation channel subfamily M member 2 (EC:3.6.1.13)
Alternative name(s):
Estrogen-responsive element-associated gene 1 protein
Long transient receptor potential channel 2
Short name:
LTrpC-2
Short name:
LTrpC2
Transient receptor potential channel 7
Short name:
TrpC7
Gene namesi
Name:TRPM2
Synonyms:EREG1, KNP3, LTRPC2, TRPC7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 21

Organism-specific databases

HGNCiHGNC:12339. TRPM2.

Subcellular locationi

Membrane; Multi-pass membrane protein 2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 752752Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei753 – 77321Helical; Reviewed predictionAdd
BLAST
Topological domaini774 – 79522Extracellular Reviewed predictionAdd
BLAST
Transmembranei796 – 81621Helical; Reviewed predictionAdd
BLAST
Topological domaini817 – 87256Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei873 – 89321Helical; Reviewed predictionAdd
BLAST
Topological domaini894 – 8963Extracellular Reviewed prediction
Transmembranei897 – 91721Helical; Reviewed predictionAdd
BLAST
Topological domaini918 – 93619Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei937 – 95721Helical; Reviewed predictionAdd
BLAST
Topological domaini958 – 102568Extracellular Reviewed predictionAdd
BLAST
Transmembranei1026 – 104621Helical; Reviewed predictionAdd
BLAST
Topological domaini1047 – 1503457Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1397 – 13971M → I: Only slight effect on activity. 1 Publication

Organism-specific databases

PharmGKBiPA37012.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 15031503Transient receptor potential cation channel subfamily M member 2PRO_0000215326Add
BLAST

Proteomic databases

PaxDbiO94759.
PRIDEiO94759.

PTM databases

PhosphoSiteiO94759.

Expressioni

Tissue specificityi

Highly expressed in brain and peripheral blood cells, such as neutrophils. Also detected in bone marrow, spleen, heart, liver and lung. Isoform 2 is found in neutrophil granulocytes.2 Publications

Inductioni

NAD+.3 Publications

Gene expression databases

ArrayExpressiO94759.
BgeeiO94759.
CleanExiHS_TRPC7.
HS_TRPM2.
GenevestigatoriO94759.

Organism-specific databases

HPAiHPA030974.

Interactioni

Subunit structurei

Isoform 1 can interact with isoform 3. This interaction decreases calcium influx through isoform 1 and suppresses susceptibility to oxidative stress-induced cell death.

Protein-protein interaction databases

BioGridi113077. 1 interaction.
STRINGi9606.ENSP00000300482.

Structurei

3D structure databases

ProteinModelPortaliO94759.
SMRiO94759. Positions 1236-1503.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1354 – 1498145Nudix hydrolaseAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG253824.
HOGENOMiHOG000236350.
HOVERGENiHBG055825.
KOiK04977.
OrthoDBiEOG725DH1.
PhylomeDBiO94759.
TreeFamiTF314204.

Family and domain databases

Gene3Di3.90.79.10. 1 hit.
InterProiIPR005821. Ion_trans_dom.
IPR000086. NUDIX_hydrolase_dom.
IPR015797. NUDIX_hydrolase_dom-like.
IPR029594. TRPM2.
[Graphical view]
PANTHERiPTHR13800:SF2. PTHR13800:SF2. 1 hit.
PfamiPF00520. Ion_trans. 1 hit.
[Graphical view]
SUPFAMiSSF55811. SSF55811. 1 hit.
PROSITEiPS51462. NUDIX. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O94759-1) [UniParc]FASTAAdd to Basket

Also known as: TRPM2-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEPSALRKAG SEQEEGFEGL PRRVTDLGMV SNLRRSNSSL FKSWRLQCPF     50
GNNDKQESLS SWIPENIKKK ECVYFVESSK LSDAGKVVCQ CGYTHEQHLE 100
EATKPHTFQG TQWDPKKHVQ EMPTDAFGDI VFTGLSQKVK KYVRVSQDTP 150
SSVIYHLMTQ HWGLDVPNLL ISVTGGAKNF NMKPRLKSIF RRGLVKVAQT 200
TGAWIITGGS HTGVMKQVGE AVRDFSLSSS YKEGELITIG VATWGTVHRR 250
EGLIHPTGSF PAEYILDEDG QGNLTCLDSN HSHFILVDDG THGQYGVEIP 300
LRTRLEKFIS EQTKERGGVA IKIPIVCVVL EGGPGTLHTI DNATTNGTPC 350
VVVEGSGRVA DVIAQVANLP VSDITISLIQ QKLSVFFQEM FETFTESRIV 400
EWTKKIQDIV RRRQLLTVFR EGKDGQQDVD VAILQALLKA SRSQDHFGHE 450
NWDHQLKLAV AWNRVDIARS EIFMDEWQWK PSDLHPTMTA ALISNKPEFV 500
KLFLENGVQL KEFVTWDTLL YLYENLDPSC LFHSKLQKVL VEDPERPACA 550
PAAPRLQMHH VAQVLRELLG DFTQPLYPRP RHNDRLRLLL PVPHVKLNVQ 600
GVSLRSLYKR SSGHVTFTMD PIRDLLIWAI VQNRRELAGI IWAQSQDCIA 650
AALACSKILK ELSKEEEDTD SSEEMLALAE EYEHRAIGVF TECYRKDEER 700
AQKLLTRVSE AWGKTTCLQL ALEAKDMKFV SHGGIQAFLT KVWWGQLSVD 750
NGLWRVTLCM LAFPLLLTGL ISFREKRLQD VGTPAARARA FFTAPVVVFH 800
LNILSYFAFL CLFAYVLMVD FQPVPSWCEC AIYLWLFSLV CEEMRQLFYD 850
PDECGLMKKA ALYFSDFWNK LDVGAILLFV AGLTCRLIPA TLYPGRVILS 900
LDFILFCLRL MHIFTISKTL GPKIIIVKRM MKDVFFFLFL LAVWVVSFGV 950
AKQAILIHNE RRVDWLFRGA VYHSYLTIFG QIPGYIDGVN FNPEHCSPNG 1000
TDPYKPKCPE SDATQQRPAF PEWLTVLLLC LYLLFTNILL LNLLIAMFNY 1050
TFQQVQEHTD QIWKFQRHDL IEEYHGRPAA PPPFILLSHL QLFIKRVVLK 1100
TPAKRHKQLK NKLEKNEEAA LLSWEIYLKE NYLQNRQFQQ KQRPEQKIED 1150
ISNKVDAMVD LLDLDPLKRS GSMEQRLASL EEQVAQTAQA LHWIVRTLRA 1200
SGFSSEADVP TLASQKAAEE PDAEPGGRKK TEEPGDSYHV NARHLLYPNC 1250
PVTRFPVPNE KVPWETEFLI YDPPFYTAER KDAAAMDPMG DTLEPLSTIQ 1300
YNVVDGLRDR RSFHGPYTVQ AGLPLNPMGR TGLRGRGSLS CFGPNHTLYP 1350
MVTRWRRNED GAICRKSIKK MLEVLVVKLP LSEHWALPGG SREPGEMLPR 1400
KLKRILRQEH WPSFENLLKC GMEVYKGYMD DPRNTDNAWI ETVAVSVHFQ 1450
DQNDVELNRL NSNLHACDSG ASIRWQVVDR RIPLYANHKT LLQKAAAEFG 1500
AHY 1503
Length:1,503
Mass (Da):171,198
Last modified:October 23, 2007 - v2
Checksum:i02338437501ABFAB
GO
Isoform 2 (identifier: O94759-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     538-557: Missing.
     1291-1325: DTLEPLSTIQYNVVDGLRDRRSFHGPYTVQAGLPL → E

Show »
Length:1,449
Mass (Da):165,273
Checksum:iCFFA7E256DABB60B
GO
Isoform 3 (identifier: O94759-3) [UniParc]FASTAAdd to Basket

Also known as: TRPM2-S

The sequence of this isoform differs from the canonical sequence as follows:
     847-1503: Missing.

Show »
Length:846
Mass (Da):95,699
Checksum:i70B0B29CADE26939
GO

Sequence cautioni

The sequence BAB64300.1 differs from that shown. Reason: Frameshift at positions 1227 and 1237.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti52 – 521N → K.1 Publication
Corresponds to variant rs45625933 [ dbSNP | Ensembl ].
VAR_025216
Natural varianti166 – 1661V → I.1 Publication
Corresponds to variant rs45544142 [ dbSNP | Ensembl ].
VAR_025217
Natural varianti385 – 3851V → M.1 Publication
Corresponds to variant rs45485992 [ dbSNP | Ensembl ].
VAR_025218
Natural varianti543 – 5431D → E.1 Publication
Corresponds to variant rs1556314 [ dbSNP | Ensembl ].
VAR_020032
Natural varianti780 – 7801D → E.1 Publication
Corresponds to variant rs9974927 [ dbSNP | Ensembl ].
VAR_025219
Natural varianti1189 – 11891Q → R.5 Publications
Corresponds to variant rs9978351 [ dbSNP | Ensembl ].
VAR_025220
Natural varianti1199 – 11991R → W.1 Publication
Corresponds to variant rs45611537 [ dbSNP | Ensembl ].
VAR_025221
Natural varianti1201 – 12011S → G.1 Publication
Corresponds to variant rs45519835 [ dbSNP | Ensembl ].
VAR_025222
Natural varianti1249 – 12491N → S.1 Publication
Corresponds to variant rs45513700 [ dbSNP | Ensembl ].
VAR_025223
Natural varianti1347 – 13471T → M.1 Publication
Corresponds to variant rs45589233 [ dbSNP | Ensembl ].
VAR_025224
Natural varianti1359 – 13591E → K.1 Publication
Corresponds to variant rs45570639 [ dbSNP | Ensembl ].
VAR_025225
Natural varianti1368 – 13681I → M.1 Publication
Corresponds to variant rs45613636 [ dbSNP | Ensembl ].
VAR_025226
Natural varianti1438 – 14381A → S.1 Publication
Corresponds to variant rs45578242 [ dbSNP | Ensembl ].
VAR_025227

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei538 – 55720Missing in isoform 2. VSP_006574Add
BLAST
Alternative sequencei847 – 1503657Missing in isoform 3. VSP_013018Add
BLAST
Alternative sequencei1291 – 132535DTLEP…AGLPL → E in isoform 2. VSP_006575Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1088 – 10881S → N in CAD01139. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB001535 mRNA. Translation: BAA34700.1.
AJ417076 mRNA. Translation: CAD01139.1.
AY603182 mRNA. Translation: AAT12288.1.
AB166745 mRNA. Translation: BAD83705.1.
AJ878416 mRNA. Translation: CAI47593.1.
DQ012935 Genomic DNA. Translation: AAY22174.1.
AP001754 Genomic DNA. Translation: BAA95563.1.
CH471079 Genomic DNA. Translation: EAX09426.1.
CH471079 Genomic DNA. Translation: EAX09427.1.
AB017549 mRNA. Translation: BAB64300.1. Frameshift.
CCDSiCCDS13710.1. [O94759-1]
RefSeqiNP_003298.1. NM_003307.3.
XP_005261228.1. XM_005261171.1. [O94759-1]
UniGeneiHs.369759.

Genome annotation databases

EnsembliENST00000300481; ENSP00000300481; ENSG00000142185. [O94759-2]
ENST00000300482; ENSP00000300482; ENSG00000142185. [O94759-1]
ENST00000397928; ENSP00000381023; ENSG00000142185. [O94759-1]
GeneIDi7226.
KEGGihsa:7226.
UCSCiuc002zet.1. human. [O94759-1]
uc002zey.1. human. [O94759-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB001535 mRNA. Translation: BAA34700.1 .
AJ417076 mRNA. Translation: CAD01139.1 .
AY603182 mRNA. Translation: AAT12288.1 .
AB166745 mRNA. Translation: BAD83705.1 .
AJ878416 mRNA. Translation: CAI47593.1 .
DQ012935 Genomic DNA. Translation: AAY22174.1 .
AP001754 Genomic DNA. Translation: BAA95563.1 .
CH471079 Genomic DNA. Translation: EAX09426.1 .
CH471079 Genomic DNA. Translation: EAX09427.1 .
AB017549 mRNA. Translation: BAB64300.1 . Frameshift.
CCDSi CCDS13710.1. [O94759-1 ]
RefSeqi NP_003298.1. NM_003307.3.
XP_005261228.1. XM_005261171.1. [O94759-1 ]
UniGenei Hs.369759.

3D structure databases

ProteinModelPortali O94759.
SMRi O94759. Positions 1236-1503.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113077. 1 interaction.
STRINGi 9606.ENSP00000300482.

Chemistry

ChEMBLi CHEMBL1250402.
GuidetoPHARMACOLOGYi 494.

Protein family/group databases

TCDBi 1.A.4.5.5. the transient receptor potential ca(2+) channel (trp-cc) family.

PTM databases

PhosphoSitei O94759.

Proteomic databases

PaxDbi O94759.
PRIDEi O94759.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000300481 ; ENSP00000300481 ; ENSG00000142185 . [O94759-2 ]
ENST00000300482 ; ENSP00000300482 ; ENSG00000142185 . [O94759-1 ]
ENST00000397928 ; ENSP00000381023 ; ENSG00000142185 . [O94759-1 ]
GeneIDi 7226.
KEGGi hsa:7226.
UCSCi uc002zet.1. human. [O94759-1 ]
uc002zey.1. human. [O94759-2 ]

Organism-specific databases

CTDi 7226.
GeneCardsi GC21P045770.
HGNCi HGNC:12339. TRPM2.
HPAi HPA030974.
MIMi 603749. gene.
neXtProti NX_O94759.
PharmGKBi PA37012.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG253824.
HOGENOMi HOG000236350.
HOVERGENi HBG055825.
KOi K04977.
OrthoDBi EOG725DH1.
PhylomeDBi O94759.
TreeFami TF314204.

Enzyme and pathway databases

Reactomei REACT_169333. TRP channels.

Miscellaneous databases

GeneWikii TRPM2.
GenomeRNAii 7226.
NextBioi 28299.
PROi O94759.
SOURCEi Search...

Gene expression databases

ArrayExpressi O94759.
Bgeei O94759.
CleanExi HS_TRPC7.
HS_TRPM2.
Genevestigatori O94759.

Family and domain databases

Gene3Di 3.90.79.10. 1 hit.
InterProi IPR005821. Ion_trans_dom.
IPR000086. NUDIX_hydrolase_dom.
IPR015797. NUDIX_hydrolase_dom-like.
IPR029594. TRPM2.
[Graphical view ]
PANTHERi PTHR13800:SF2. PTHR13800:SF2. 1 hit.
Pfami PF00520. Ion_trans. 1 hit.
[Graphical view ]
SUPFAMi SSF55811. SSF55811. 1 hit.
PROSITEi PS51462. NUDIX. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of a novel putative Ca2+ channel protein (TRPC7) highly expressed in brain."
    Nagamine K., Kudoh J., Minoshima S., Kawasaki K., Asakawa S., Ito F., Shimizu N.
    Genomics 54:124-131(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-1189.
    Tissue: Brain.
  2. "Activation of the cation channel long transient receptor potential channel 2 (LTRPC2) by hydrogen peroxide. A splice variant reveals a mode of activation independent of ADP-ribose."
    Wehage E., Eisfeld J., Heiner I., Juengling E., Zitt C., Lueckhoff A.
    J. Biol. Chem. 277:23150-23156(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT ARG-1189, REGULATION BY OXIDATIVE STRESS.
    Tissue: Promyelocytic leukemia.
  3. "A novel TRPM2 isoform inhibits calcium influx and susceptibility to cell death."
    Zhang W., Chu X., Tong Q., Cheung J.Y., Conrad K., Masker K., Miller B.A.
    J. Biol. Chem. 278:16222-16229(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT ARG-1189, INTERACTION BETWEEN ISOFORMS 1 AND 3, SUBCELLULAR LOCATION.
    Tissue: Bone marrow.
  4. "Characterization of human and mouse TRPM2 genes: identification of a novel N-terminal truncated protein specifically expressed in human striatum."
    Uemura T., Kudoh J., Noda S., Kanba S., Shimizu N.
    Biochem. Biophys. Res. Commun. 328:1232-1243(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-1189.
    Tissue: Brain.
  5. "Cloning of the human TRPM2."
    Hayes P.D.
    Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-1189.
  6. NIEHS SNPs program
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-52; ILE-166; MET-385; GLU-543; GLU-780; TRP-1199; GLY-1201; SER-1249; MET-1347; LYS-1359; MET-1368 AND SER-1438.
  7. "The DNA sequence of human chromosome 21."
    Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A.
    , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.
    Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "Molecular cloning of a novel estrogen responsive gene, estrogen responsive element associated gene 1 (EREG1), which contains MutT like domain."
    Hiroi H., Muramatsu M., Inoue S.
    Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1190-1503.
  10. "ADP-ribose gating of the calcium-permeable LTRPC2 channel revealed by Nudix motif homology."
    Perraud A.-L., Fleig A., Dunn C.A., Bagley L.A., Launay P., Schmitz C., Stokes A.J., Zhu Q., Bessman M.J., Penner R., Kinet J.-P., Scharenberg A.M.
    Nature 411:595-599(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: CATALYTIC ACTIVITY, REGULATION BY ADP-RIBOSE, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  11. Cited for: REGULATION BY PYRIMIDINE NUCLEOTIDES, TISSUE SPECIFICITY.
  12. "LTRPC2 Ca2+-permeable channel activated by changes in redox status confers susceptibility to cell death."
    Hara Y., Wakamori M., Ishii M., Maeno E., Nishida M., Yoshida T., Yamada H., Shimizu S., Mori E., Kudoh J., Shimizu N., Kurose H., Okada Y., Imoto K., Mori Y.
    Mol. Cell 9:163-173(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF MET-1397.

Entry informationi

Entry nameiTRPM2_HUMAN
AccessioniPrimary (citable) accession number: O94759
Secondary accession number(s): D3DSL6
, Q5KTC2, Q6J3P5, Q96KN6, Q96Q93
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 23, 2007
Last modified: September 3, 2014
This is version 140 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi