O94759 (TRPM2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transient receptor potential cation channel subfamily M member 2 EC=3.6.1.13 Alternative name(s): Estrogen-responsive element-associated gene 1 protein Long transient receptor potential channel 2 Short name=LTrpC-2 Short name=LTrpC2 Transient receptor potential channel 7 Short name=TrpC7 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1503 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Nonselective, voltage-independent cation channel mediating sodium and calcium ion influx in response to oxidative stress. Extracellular calcium passes through the channel and acts from the intracellular side as a positive regulator in channel activation. Activated by ADP-ribose, nicotinamide adenine dinucleotide (NAD+), reactive nitrogen species and arachidonic acid. Inactivated by intracellular ATP. Confers susceptibility to cell death following oxidative stress. Isoform 2 does not seem to be regulated by ADPR. Has ADP-ribose pyrophosphatase activity. Ref.12 |
| Catalytic activity | ADP-ribose + H2O = AMP + D-ribose 5-phosphate. Ref.10 |
| Subunit structure | Isoform 1 can interact with isoform 3. This interaction decreases calcium influx through isoform 1 and suppresses susceptibility to oxidative stress-induced cell death. |
| Subcellular location | |
| Tissue specificity | Highly expressed in brain and peripheral blood cells, such as neutrophils. Also detected in bone marrow, spleen, heart, liver and lung. Isoform 2 is found in neutrophil granulocytes. Ref.10 Ref.11 |
| Induction | |
| Sequence similarities | Belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM2 sub-subfamily. [View classification] Contains 1 nudix hydrolase domain. |
| Biophysicochemical properties | Kinetic parameters: KM=100 µM for ADP-ribose Vmax=0.1 µmol/min/mg enzyme |
| Sequence caution | The sequence BAB64300.1 differs from that shown. Reason: Frameshift at positions 1227 and 1237. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Calcium transport Ion transport Sodium transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Calcium NAD Sodium |
| Molecular function | Calcium channel Hydrolase Ionic channel Sodium channel |
| PTM | Acetylation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | integral to plasma membrane Traceable author statement. Source: ProtInc |
| Molecular function | ADP-ribose diphosphatase activity Inferred from electronic annotation. Source: EC calcium channel activityTraceable author statement. Source: ProtInc sodium channel activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94759-1) Also known as: TRPM2-L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94759-2) The sequence of this isoform differs from the canonical sequence as follows: 538-557: Missing. 1291-1325: DTLEPLSTIQYNVVDGLRDRRSFHGPYTVQAGLPL → E | ||||||
| Isoform 3 (identifier: O94759-3) Also known as: TRPM2-S; The sequence of this isoform differs from the canonical sequence as follows: 847-1503: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1503 | 1503 | Transient receptor potential cation channel subfamily M member 2 | PRO_0000215326 | |||||
Regions | |||||||||
| Topological domain | 1 – 752 | 752 | Cytoplasmic Potential | ||||||
| Transmembrane | 753 – 773 | 21 | Helical; Potential | ||||||
| Topological domain | 774 – 795 | 22 | Extracellular Potential | ||||||
| Transmembrane | 796 – 816 | 21 | Helical; Potential | ||||||
| Topological domain | 817 – 872 | 56 | Cytoplasmic Potential | ||||||
| Transmembrane | 873 – 893 | 21 | Helical; Potential | ||||||
| Topological domain | 894 – 896 | 3 | Extracellular Potential | ||||||
| Transmembrane | 897 – 917 | 21 | Helical; Potential | ||||||
| Topological domain | 918 – 936 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 937 – 957 | 21 | Helical; Potential | ||||||
| Topological domain | 958 – 1025 | 68 | Extracellular Potential | ||||||
| Transmembrane | 1026 – 1046 | 21 | Helical; Potential | ||||||
| Topological domain | 1047 – 1503 | 457 | Cytoplasmic Potential | ||||||
| Domain | 1354 – 1498 | 145 | Nudix hydrolase | ||||||
| Nucleotide binding | 1390 – 1412 | 23 | NAD | ||||||
Amino acid modifications | |||||||||
| Modified residue | 405 | 1 | N6-acetyllysine Ref.13 | ||||||
| Modified residue | 1104 | 1 | N6-acetyllysine Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 538 – 557 | 20 | Missing in isoform 2. | VSP_006574 | |||||
| Alternative sequence | 847 – 1503 | 657 | Missing in isoform 3. | VSP_013018 | |||||
| Alternative sequence | 1291 – 1325 | 35 | DTLEP…AGLPL → E in isoform 2. | VSP_006575 | |||||
| Natural variant | 52 | 1 | N → K. Ref.6 Corresponds to variant rs45625933 [ dbSNP | Ensembl ]. | VAR_025216 | |||||
| Natural variant | 166 | 1 | V → I. Ref.6 Corresponds to variant rs45544142 [ dbSNP | Ensembl ]. | VAR_025217 | |||||
| Natural variant | 385 | 1 | V → M. Ref.6 Corresponds to variant rs45485992 [ dbSNP | Ensembl ]. | VAR_025218 | |||||
| Natural variant | 543 | 1 | D → E. Ref.6 Corresponds to variant rs1556314 [ dbSNP | Ensembl ]. | VAR_020032 | |||||
| Natural variant | 780 | 1 | D → E. Ref.6 Corresponds to variant rs9974927 [ dbSNP | Ensembl ]. | VAR_025219 | |||||
| Natural variant | 1189 | 1 | Q → R. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Corresponds to variant rs9978351 [ dbSNP | Ensembl ]. | VAR_025220 | |||||
| Natural variant | 1199 | 1 | R → W. Ref.6 Corresponds to variant rs45611537 [ dbSNP | Ensembl ]. | VAR_025221 | |||||
| Natural variant | 1201 | 1 | S → G. Ref.6 Corresponds to variant rs45519835 [ dbSNP | Ensembl ]. | VAR_025222 | |||||
| Natural variant | 1249 | 1 | N → S. Ref.6 Corresponds to variant rs45513700 [ dbSNP | Ensembl ]. | VAR_025223 | |||||
| Natural variant | 1347 | 1 | T → M. Ref.6 Corresponds to variant rs45589233 [ dbSNP | Ensembl ]. | VAR_025224 | |||||
| Natural variant | 1359 | 1 | E → K. Ref.6 Corresponds to variant rs45570639 [ dbSNP | Ensembl ]. | VAR_025225 | |||||
| Natural variant | 1368 | 1 | I → M. Ref.6 Corresponds to variant rs45613636 [ dbSNP | Ensembl ]. | VAR_025226 | |||||
| Natural variant | 1438 | 1 | A → S. Ref.6 Corresponds to variant rs45578242 [ dbSNP | Ensembl ]. | VAR_025227 | |||||
Experimental info | |||||||||
| Mutagenesis | 1397 | 1 | M → I: Only slight effect on activity. Ref.12 | ||||||
| Sequence conflict | 1088 | 1 | S → N in CAD01139. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of a novel putative Ca2+ channel protein (TRPC7) highly expressed in brain." Nagamine K., Kudoh J., Minoshima S., Kawasaki K., Asakawa S., Ito F., Shimizu N. Genomics 54:124-131(1998) [PubMed: 9806837] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-1189. Tissue: Brain. |
| [2] | "Activation of the cation channel long transient receptor potential channel 2 (LTRPC2) by hydrogen peroxide. A splice variant reveals a mode of activation independent of ADP-ribose." Wehage E., Eisfeld J., Heiner I., Juengling E., Zitt C., Lueckhoff A. J. Biol. Chem. 277:23150-23156(2002) [PubMed: 11960981] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT ARG-1189, REGULATION BY OXIDATIVE STRESS. Tissue: Promyelocytic leukemia. |
| [3] | "A novel TRPM2 isoform inhibits calcium influx and susceptibility to cell death." Zhang W., Chu X., Tong Q., Cheung J.Y., Conrad K., Masker K., Miller B.A. J. Biol. Chem. 278:16222-16229(2003) [PubMed: 12594222] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT ARG-1189, INTERACTION BETWEEN ISOFORMS 1 AND 3, SUBCELLULAR LOCATION. Tissue: Bone marrow. |
| [4] | "Characterization of human and mouse TRPM2 genes: identification of a novel N-terminal truncated protein specifically expressed in human striatum." Uemura T., Kudoh J., Noda S., Kanba S., Shimizu N. Biochem. Biophys. Res. Commun. 328:1232-1243(2005) [PubMed: 15708008] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-1189. Tissue: Brain. |
| [5] | "Cloning of the human TRPM2." Hayes P.D. Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-1189. |
| [6] | NIEHS SNPs program Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-52; ILE-166; MET-385; GLU-543; GLU-780; TRP-1199; GLY-1201; SER-1249; MET-1347; LYS-1359; MET-1368 AND SER-1438. |
| [7] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed: 10830953] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "Molecular cloning of a novel estrogen responsive gene, estrogen responsive element associated gene 1 (EREG1), which contains MutT like domain." Hiroi H., Muramatsu M., Inoue S. Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1190-1503. |
| [10] | "ADP-ribose gating of the calcium-permeable LTRPC2 channel revealed by Nudix motif homology." Perraud A.-L., Fleig A., Dunn C.A., Bagley L.A., Launay P., Schmitz C., Stokes A.J., Zhu Q., Bessman M.J., Penner R., Kinet J.-P., Scharenberg A.M. Nature 411:595-599(2001) [PubMed: 11385575] [Abstract] Cited for: CATALYTIC ACTIVITY, REGULATION BY ADP-RIBOSE, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [11] | "Immunocyte Ca2+ influx system mediated by LTRPC2." Sano Y., Inamura K., Miyake A., Mochizuki S., Yokoi H., Matsushime H., Furuichi K. Science 293:1327-1330(2001) [PubMed: 11509734] [Abstract] Cited for: REGULATION BY PYRIMIDINE NUCLEOTIDES, TISSUE SPECIFICITY. |
| [12] | "LTRPC2 Ca2+-permeable channel activated by changes in redox status confers susceptibility to cell death." Hara Y., Wakamori M., Ishii M., Maeno E., Nishida M., Yoshida T., Yamada H., Shimizu S., Mori E., Kudoh J., Shimizu N., Kurose H., Okada Y., Imoto K., Mori Y. Mol. Cell 9:163-173(2002) [PubMed: 11804595] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF MET-1397. |
| [13] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-405 AND LYS-1104, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB001535 mRNA. Translation: BAA34700.1. AJ417076 mRNA. Translation: CAD01139.1. AY603182 mRNA. Translation: AAT12288.1. AB166745 mRNA. Translation: BAD83705.1. AJ878416 mRNA. Translation: CAI47593.1. DQ012935 Genomic DNA. Translation: AAY22174.1. AP001754 Genomic DNA. Translation: BAA95563.1. CH471079 Genomic DNA. Translation: EAX09426.1. CH471079 Genomic DNA. Translation: EAX09427.1. AB017549 mRNA. Translation: BAB64300.1. Frameshift. |
| IPI | IPI00014911. IPI00412399. IPI00480087. |
| RefSeq | NP_003298.1. NM_003307.3. |
| UniGene | Hs.369759. |
3D structure databases | |
| ProteinModelPortal | O94759. |
| SMR | O94759. Positions 1237-1503. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O94759. |
Protein family/group databases | |
| TCDB | 1.A.4.5.5. transient receptor potential Ca2+ channel (TRP-CC) family. |
PTM databases | |
| PhosphoSite | O94759. |
Proteomic databases | |
| PRIDE | O94759. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000300482; ENSP00000300482; ENSG00000142185. ENST00000397928; ENSP00000381023; ENSG00000142185. |
| GeneID | 7226. |
| KEGG | hsa:7226. |
| NMPDR | fig|9606.3.peg.21072. |
| UCSC | uc002zet.1. human. |
Organism-specific databases | |
| CTD | 7226. |
| GeneCards | GC21P045770. |
| HGNC | HGNC:12339. TRPM2. |
| HPA | HPA030974. |
| MIM | 603749. gene. |
| neXtProt | NX_O94759. |
| PharmGKB | PA37012. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG13332. |
| HOVERGEN | HBG055825. |
| OrthoDB | EOG4BVRSV. |
| PhylomeDB | O94759. |
Gene expression databases | |
| ArrayExpress | O94759. |
| Bgee | O94759. |
| CleanEx | HS_TRPC7. HS_TRPM2. |
| Genevestigator | O94759. |
| GermOnline | ENSG00000142185. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR005821. Ion_trans. IPR000086. NUDIX_hydrolase_dom. IPR015797. NUDIX_hydrolase_dom-like. [Graphical view] |
| KO | K04977. |
| Pfam | PF00520. Ion_trans. 1 hit. [Graphical view] |
| SUPFAM | SSF55811. NUDIX_hydrolase. 1 hit. |
| PROSITE | PS51462. NUDIX. 1 hit. PS00893. NUDIX_BOX. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 28299. |
| SOURCE | Search... |
Entry information
| Entry name | TRPM2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94759 Secondary accession number(s): D3DSL6 Q96Q93 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with