Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O94759

- TRPM2_HUMAN

UniProt

O94759 - TRPM2_HUMAN

Protein

Transient receptor potential cation channel subfamily M member 2

Gene

TRPM2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 141 (01 Oct 2014)
      Sequence version 2 (23 Oct 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Nonselective, voltage-independent cation channel mediating sodium and calcium ion influx in response to oxidative stress. Extracellular calcium passes through the channel and acts from the intracellular side as a positive regulator in channel activation. Activated by ADP-ribose, nicotinamide adenine dinucleotide (NAD+), reactive nitrogen species and arachidonic acid. Inactivated by intracellular ATP. Confers susceptibility to cell death following oxidative stress. Isoform 2 does not seem to be regulated by ADPR. Has ADP-ribose pyrophosphatase activity.1 Publication

    Catalytic activityi

    ADP-D-ribose + H2O = AMP + D-ribose 5-phosphate.1 Publication

    Kineticsi

    1. KM=100 µM for ADP-ribose

    Vmax=0.1 µmol/min/mg enzyme

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi1390 – 141223NADAdd
    BLAST

    GO - Molecular functioni

    1. ADP-ribose diphosphatase activity Source: UniProtKB-EC
    2. calcium channel activity Source: ProtInc
    3. manganese ion transmembrane transporter activity Source: Ensembl
    4. sodium channel activity Source: UniProtKB-KW

    GO - Biological processi

    1. calcium ion transmembrane transport Source: Reactome
    2. calcium ion transport Source: ProtInc
    3. ion transmembrane transport Source: Reactome
    4. response to hydroperoxide Source: Ensembl
    5. transmembrane transport Source: Reactome

    Keywords - Molecular functioni

    Calcium channel, Hydrolase, Ion channel, Sodium channel

    Keywords - Biological processi

    Calcium transport, Ion transport, Sodium transport, Transport

    Keywords - Ligandi

    Calcium, NAD, Sodium

    Enzyme and pathway databases

    ReactomeiREACT_169333. TRP channels.

    Protein family/group databases

    TCDBi1.A.4.5.5. the transient receptor potential ca(2+) channel (trp-cc) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transient receptor potential cation channel subfamily M member 2 (EC:3.6.1.13)
    Alternative name(s):
    Estrogen-responsive element-associated gene 1 protein
    Long transient receptor potential channel 2
    Short name:
    LTrpC-2
    Short name:
    LTrpC2
    Transient receptor potential channel 7
    Short name:
    TrpC7
    Gene namesi
    Name:TRPM2
    Synonyms:EREG1, KNP3, LTRPC2, TRPC7
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 21

    Organism-specific databases

    HGNCiHGNC:12339. TRPM2.

    Subcellular locationi

    Membrane 2 Publications; Multi-pass membrane protein 2 Publications

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi1397 – 13971M → I: Only slight effect on activity. 1 Publication

    Organism-specific databases

    PharmGKBiPA37012.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 15031503Transient receptor potential cation channel subfamily M member 2PRO_0000215326Add
    BLAST

    Proteomic databases

    PaxDbiO94759.
    PRIDEiO94759.

    PTM databases

    PhosphoSiteiO94759.

    Expressioni

    Tissue specificityi

    Highly expressed in brain and peripheral blood cells, such as neutrophils. Also detected in bone marrow, spleen, heart, liver and lung. Isoform 2 is found in neutrophil granulocytes.2 Publications

    Inductioni

    NAD+.

    Gene expression databases

    ArrayExpressiO94759.
    BgeeiO94759.
    CleanExiHS_TRPC7.
    HS_TRPM2.
    GenevestigatoriO94759.

    Organism-specific databases

    HPAiHPA030974.

    Interactioni

    Subunit structurei

    Isoform 1 can interact with isoform 3. This interaction decreases calcium influx through isoform 1 and suppresses susceptibility to oxidative stress-induced cell death.

    Protein-protein interaction databases

    BioGridi113077. 1 interaction.
    STRINGi9606.ENSP00000300482.

    Structurei

    3D structure databases

    ProteinModelPortaliO94759.
    SMRiO94759. Positions 1236-1503.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 752752CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini774 – 79522ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini817 – 87256CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini894 – 8963ExtracellularSequence Analysis
    Topological domaini918 – 93619CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini958 – 102568ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1047 – 1503457CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei753 – 77321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei796 – 81621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei873 – 89321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei897 – 91721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei937 – 95721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1026 – 104621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1354 – 1498145Nudix hydrolasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 nudix hydrolase domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG253824.
    HOGENOMiHOG000236350.
    HOVERGENiHBG055825.
    KOiK04977.
    OrthoDBiEOG725DH1.
    PhylomeDBiO94759.
    TreeFamiTF314204.

    Family and domain databases

    Gene3Di3.90.79.10. 1 hit.
    InterProiIPR005821. Ion_trans_dom.
    IPR000086. NUDIX_hydrolase_dom.
    IPR015797. NUDIX_hydrolase_dom-like.
    IPR029594. TRPM2.
    [Graphical view]
    PANTHERiPTHR13800:SF2. PTHR13800:SF2. 1 hit.
    PfamiPF00520. Ion_trans. 1 hit.
    [Graphical view]
    SUPFAMiSSF55811. SSF55811. 1 hit.
    PROSITEiPS51462. NUDIX. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O94759-1) [UniParc]FASTAAdd to Basket

    Also known as: TRPM2-L

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEPSALRKAG SEQEEGFEGL PRRVTDLGMV SNLRRSNSSL FKSWRLQCPF     50
    GNNDKQESLS SWIPENIKKK ECVYFVESSK LSDAGKVVCQ CGYTHEQHLE 100
    EATKPHTFQG TQWDPKKHVQ EMPTDAFGDI VFTGLSQKVK KYVRVSQDTP 150
    SSVIYHLMTQ HWGLDVPNLL ISVTGGAKNF NMKPRLKSIF RRGLVKVAQT 200
    TGAWIITGGS HTGVMKQVGE AVRDFSLSSS YKEGELITIG VATWGTVHRR 250
    EGLIHPTGSF PAEYILDEDG QGNLTCLDSN HSHFILVDDG THGQYGVEIP 300
    LRTRLEKFIS EQTKERGGVA IKIPIVCVVL EGGPGTLHTI DNATTNGTPC 350
    VVVEGSGRVA DVIAQVANLP VSDITISLIQ QKLSVFFQEM FETFTESRIV 400
    EWTKKIQDIV RRRQLLTVFR EGKDGQQDVD VAILQALLKA SRSQDHFGHE 450
    NWDHQLKLAV AWNRVDIARS EIFMDEWQWK PSDLHPTMTA ALISNKPEFV 500
    KLFLENGVQL KEFVTWDTLL YLYENLDPSC LFHSKLQKVL VEDPERPACA 550
    PAAPRLQMHH VAQVLRELLG DFTQPLYPRP RHNDRLRLLL PVPHVKLNVQ 600
    GVSLRSLYKR SSGHVTFTMD PIRDLLIWAI VQNRRELAGI IWAQSQDCIA 650
    AALACSKILK ELSKEEEDTD SSEEMLALAE EYEHRAIGVF TECYRKDEER 700
    AQKLLTRVSE AWGKTTCLQL ALEAKDMKFV SHGGIQAFLT KVWWGQLSVD 750
    NGLWRVTLCM LAFPLLLTGL ISFREKRLQD VGTPAARARA FFTAPVVVFH 800
    LNILSYFAFL CLFAYVLMVD FQPVPSWCEC AIYLWLFSLV CEEMRQLFYD 850
    PDECGLMKKA ALYFSDFWNK LDVGAILLFV AGLTCRLIPA TLYPGRVILS 900
    LDFILFCLRL MHIFTISKTL GPKIIIVKRM MKDVFFFLFL LAVWVVSFGV 950
    AKQAILIHNE RRVDWLFRGA VYHSYLTIFG QIPGYIDGVN FNPEHCSPNG 1000
    TDPYKPKCPE SDATQQRPAF PEWLTVLLLC LYLLFTNILL LNLLIAMFNY 1050
    TFQQVQEHTD QIWKFQRHDL IEEYHGRPAA PPPFILLSHL QLFIKRVVLK 1100
    TPAKRHKQLK NKLEKNEEAA LLSWEIYLKE NYLQNRQFQQ KQRPEQKIED 1150
    ISNKVDAMVD LLDLDPLKRS GSMEQRLASL EEQVAQTAQA LHWIVRTLRA 1200
    SGFSSEADVP TLASQKAAEE PDAEPGGRKK TEEPGDSYHV NARHLLYPNC 1250
    PVTRFPVPNE KVPWETEFLI YDPPFYTAER KDAAAMDPMG DTLEPLSTIQ 1300
    YNVVDGLRDR RSFHGPYTVQ AGLPLNPMGR TGLRGRGSLS CFGPNHTLYP 1350
    MVTRWRRNED GAICRKSIKK MLEVLVVKLP LSEHWALPGG SREPGEMLPR 1400
    KLKRILRQEH WPSFENLLKC GMEVYKGYMD DPRNTDNAWI ETVAVSVHFQ 1450
    DQNDVELNRL NSNLHACDSG ASIRWQVVDR RIPLYANHKT LLQKAAAEFG 1500
    AHY 1503
    Length:1,503
    Mass (Da):171,198
    Last modified:October 23, 2007 - v2
    Checksum:i02338437501ABFAB
    GO
    Isoform 2 (identifier: O94759-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         538-557: Missing.
         1291-1325: DTLEPLSTIQYNVVDGLRDRRSFHGPYTVQAGLPL → E

    Show »
    Length:1,449
    Mass (Da):165,273
    Checksum:iCFFA7E256DABB60B
    GO
    Isoform 3 (identifier: O94759-3) [UniParc]FASTAAdd to Basket

    Also known as: TRPM2-S

    The sequence of this isoform differs from the canonical sequence as follows:
         847-1503: Missing.

    Show »
    Length:846
    Mass (Da):95,699
    Checksum:i70B0B29CADE26939
    GO

    Sequence cautioni

    The sequence BAB64300.1 differs from that shown. Reason: Frameshift at positions 1227 and 1237.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1088 – 10881S → N in CAD01139. (PubMed:11960981)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti52 – 521N → K.1 Publication
    Corresponds to variant rs45625933 [ dbSNP | Ensembl ].
    VAR_025216
    Natural varianti166 – 1661V → I.1 Publication
    Corresponds to variant rs45544142 [ dbSNP | Ensembl ].
    VAR_025217
    Natural varianti385 – 3851V → M.1 Publication
    Corresponds to variant rs45485992 [ dbSNP | Ensembl ].
    VAR_025218
    Natural varianti543 – 5431D → E.1 Publication
    Corresponds to variant rs1556314 [ dbSNP | Ensembl ].
    VAR_020032
    Natural varianti780 – 7801D → E.1 Publication
    Corresponds to variant rs9974927 [ dbSNP | Ensembl ].
    VAR_025219
    Natural varianti1189 – 11891Q → R.5 Publications
    Corresponds to variant rs9978351 [ dbSNP | Ensembl ].
    VAR_025220
    Natural varianti1199 – 11991R → W.1 Publication
    Corresponds to variant rs45611537 [ dbSNP | Ensembl ].
    VAR_025221
    Natural varianti1201 – 12011S → G.1 Publication
    Corresponds to variant rs45519835 [ dbSNP | Ensembl ].
    VAR_025222
    Natural varianti1249 – 12491N → S.1 Publication
    Corresponds to variant rs45513700 [ dbSNP | Ensembl ].
    VAR_025223
    Natural varianti1347 – 13471T → M.1 Publication
    Corresponds to variant rs45589233 [ dbSNP | Ensembl ].
    VAR_025224
    Natural varianti1359 – 13591E → K.1 Publication
    Corresponds to variant rs45570639 [ dbSNP | Ensembl ].
    VAR_025225
    Natural varianti1368 – 13681I → M.1 Publication
    Corresponds to variant rs45613636 [ dbSNP | Ensembl ].
    VAR_025226
    Natural varianti1438 – 14381A → S.1 Publication
    Corresponds to variant rs45578242 [ dbSNP | Ensembl ].
    VAR_025227

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei538 – 55720Missing in isoform 2. 1 PublicationVSP_006574Add
    BLAST
    Alternative sequencei847 – 1503657Missing in isoform 3. 1 PublicationVSP_013018Add
    BLAST
    Alternative sequencei1291 – 132535DTLEP…AGLPL → E in isoform 2. 1 PublicationVSP_006575Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB001535 mRNA. Translation: BAA34700.1.
    AJ417076 mRNA. Translation: CAD01139.1.
    AY603182 mRNA. Translation: AAT12288.1.
    AB166745 mRNA. Translation: BAD83705.1.
    AJ878416 mRNA. Translation: CAI47593.1.
    DQ012935 Genomic DNA. Translation: AAY22174.1.
    AP001754 Genomic DNA. Translation: BAA95563.1.
    CH471079 Genomic DNA. Translation: EAX09426.1.
    CH471079 Genomic DNA. Translation: EAX09427.1.
    AB017549 mRNA. Translation: BAB64300.1. Frameshift.
    CCDSiCCDS13710.1. [O94759-1]
    RefSeqiNP_003298.1. NM_003307.3.
    XP_005261228.1. XM_005261171.1. [O94759-1]
    UniGeneiHs.369759.

    Genome annotation databases

    EnsembliENST00000300481; ENSP00000300481; ENSG00000142185. [O94759-2]
    ENST00000300482; ENSP00000300482; ENSG00000142185. [O94759-1]
    ENST00000397928; ENSP00000381023; ENSG00000142185. [O94759-1]
    GeneIDi7226.
    KEGGihsa:7226.
    UCSCiuc002zet.1. human. [O94759-1]
    uc002zey.1. human. [O94759-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB001535 mRNA. Translation: BAA34700.1 .
    AJ417076 mRNA. Translation: CAD01139.1 .
    AY603182 mRNA. Translation: AAT12288.1 .
    AB166745 mRNA. Translation: BAD83705.1 .
    AJ878416 mRNA. Translation: CAI47593.1 .
    DQ012935 Genomic DNA. Translation: AAY22174.1 .
    AP001754 Genomic DNA. Translation: BAA95563.1 .
    CH471079 Genomic DNA. Translation: EAX09426.1 .
    CH471079 Genomic DNA. Translation: EAX09427.1 .
    AB017549 mRNA. Translation: BAB64300.1 . Frameshift.
    CCDSi CCDS13710.1. [O94759-1 ]
    RefSeqi NP_003298.1. NM_003307.3.
    XP_005261228.1. XM_005261171.1. [O94759-1 ]
    UniGenei Hs.369759.

    3D structure databases

    ProteinModelPortali O94759.
    SMRi O94759. Positions 1236-1503.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113077. 1 interaction.
    STRINGi 9606.ENSP00000300482.

    Chemistry

    ChEMBLi CHEMBL1250402.
    GuidetoPHARMACOLOGYi 494.

    Protein family/group databases

    TCDBi 1.A.4.5.5. the transient receptor potential ca(2+) channel (trp-cc) family.

    PTM databases

    PhosphoSitei O94759.

    Proteomic databases

    PaxDbi O94759.
    PRIDEi O94759.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000300481 ; ENSP00000300481 ; ENSG00000142185 . [O94759-2 ]
    ENST00000300482 ; ENSP00000300482 ; ENSG00000142185 . [O94759-1 ]
    ENST00000397928 ; ENSP00000381023 ; ENSG00000142185 . [O94759-1 ]
    GeneIDi 7226.
    KEGGi hsa:7226.
    UCSCi uc002zet.1. human. [O94759-1 ]
    uc002zey.1. human. [O94759-2 ]

    Organism-specific databases

    CTDi 7226.
    GeneCardsi GC21P045770.
    HGNCi HGNC:12339. TRPM2.
    HPAi HPA030974.
    MIMi 603749. gene.
    neXtProti NX_O94759.
    PharmGKBi PA37012.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG253824.
    HOGENOMi HOG000236350.
    HOVERGENi HBG055825.
    KOi K04977.
    OrthoDBi EOG725DH1.
    PhylomeDBi O94759.
    TreeFami TF314204.

    Enzyme and pathway databases

    Reactomei REACT_169333. TRP channels.

    Miscellaneous databases

    GeneWikii TRPM2.
    GenomeRNAii 7226.
    NextBioi 28299.
    PROi O94759.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O94759.
    Bgeei O94759.
    CleanExi HS_TRPC7.
    HS_TRPM2.
    Genevestigatori O94759.

    Family and domain databases

    Gene3Di 3.90.79.10. 1 hit.
    InterProi IPR005821. Ion_trans_dom.
    IPR000086. NUDIX_hydrolase_dom.
    IPR015797. NUDIX_hydrolase_dom-like.
    IPR029594. TRPM2.
    [Graphical view ]
    PANTHERi PTHR13800:SF2. PTHR13800:SF2. 1 hit.
    Pfami PF00520. Ion_trans. 1 hit.
    [Graphical view ]
    SUPFAMi SSF55811. SSF55811. 1 hit.
    PROSITEi PS51462. NUDIX. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of a novel putative Ca2+ channel protein (TRPC7) highly expressed in brain."
      Nagamine K., Kudoh J., Minoshima S., Kawasaki K., Asakawa S., Ito F., Shimizu N.
      Genomics 54:124-131(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-1189.
      Tissue: Brain.
    2. "Activation of the cation channel long transient receptor potential channel 2 (LTRPC2) by hydrogen peroxide. A splice variant reveals a mode of activation independent of ADP-ribose."
      Wehage E., Eisfeld J., Heiner I., Juengling E., Zitt C., Lueckhoff A.
      J. Biol. Chem. 277:23150-23156(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT ARG-1189, REGULATION BY OXIDATIVE STRESS.
      Tissue: Promyelocytic leukemia.
    3. "A novel TRPM2 isoform inhibits calcium influx and susceptibility to cell death."
      Zhang W., Chu X., Tong Q., Cheung J.Y., Conrad K., Masker K., Miller B.A.
      J. Biol. Chem. 278:16222-16229(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT ARG-1189, INTERACTION BETWEEN ISOFORMS 1 AND 3, SUBCELLULAR LOCATION.
      Tissue: Bone marrow.
    4. "Characterization of human and mouse TRPM2 genes: identification of a novel N-terminal truncated protein specifically expressed in human striatum."
      Uemura T., Kudoh J., Noda S., Kanba S., Shimizu N.
      Biochem. Biophys. Res. Commun. 328:1232-1243(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-1189.
      Tissue: Brain.
    5. "Cloning of the human TRPM2."
      Hayes P.D.
      Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-1189.
    6. NIEHS SNPs program
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-52; ILE-166; MET-385; GLU-543; GLU-780; TRP-1199; GLY-1201; SER-1249; MET-1347; LYS-1359; MET-1368 AND SER-1438.
    7. "The DNA sequence of human chromosome 21."
      Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A.
      , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.
      Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "Molecular cloning of a novel estrogen responsive gene, estrogen responsive element associated gene 1 (EREG1), which contains MutT like domain."
      Hiroi H., Muramatsu M., Inoue S.
      Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1190-1503.
    10. "ADP-ribose gating of the calcium-permeable LTRPC2 channel revealed by Nudix motif homology."
      Perraud A.-L., Fleig A., Dunn C.A., Bagley L.A., Launay P., Schmitz C., Stokes A.J., Zhu Q., Bessman M.J., Penner R., Kinet J.-P., Scharenberg A.M.
      Nature 411:595-599(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: CATALYTIC ACTIVITY, REGULATION BY ADP-RIBOSE, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    11. Cited for: REGULATION BY PYRIMIDINE NUCLEOTIDES, TISSUE SPECIFICITY.
    12. "LTRPC2 Ca2+-permeable channel activated by changes in redox status confers susceptibility to cell death."
      Hara Y., Wakamori M., Ishii M., Maeno E., Nishida M., Yoshida T., Yamada H., Shimizu S., Mori E., Kudoh J., Shimizu N., Kurose H., Okada Y., Imoto K., Mori Y.
      Mol. Cell 9:163-173(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, MUTAGENESIS OF MET-1397.

    Entry informationi

    Entry nameiTRPM2_HUMAN
    AccessioniPrimary (citable) accession number: O94759
    Secondary accession number(s): D3DSL6
    , Q5KTC2, Q6J3P5, Q96KN6, Q96Q93
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: October 23, 2007
    Last modified: October 1, 2014
    This is version 141 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 21
      Human chromosome 21: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3