Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pro-neuregulin-1, membrane-bound isoform

Gene

nrg1

Organism
Xenopus laevis (African clawed frog)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Direct ligand for the ERBB tyrosine kinase receptors. Induces expression of acetylcholine receptor in synaptic nuclei.

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Growth factor

Names & Taxonomyi

Protein namesi
Recommended name:
Pro-neuregulin-1, membrane-bound isoform
Short name:
Pro-NRG1
Cleaved into the following chain:
Gene namesi
Name:nrg1
OrganismiXenopus laevis (African clawed frog)
Taxonomic identifieri8355 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiAmphibiaBatrachiaAnuraPipoideaPipidaeXenopodinaeXenopusXenopus

Organism-specific databases

XenbaseiXB-GENE-1011454. nrg1.

Subcellular locationi

Pro-neuregulin-1, membrane-bound isoform :
Neuregulin-1 :

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 260ExtracellularSequence analysisAdd BLAST260
Transmembranei261 – 280Helical; Note=Internal signal sequenceSequence analysisAdd BLAST20
Topological domaini281 – 677CytoplasmicSequence analysisAdd BLAST397

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000194701 – 677Pro-neuregulin-1, membrane-bound isoformBy similarityAdd BLAST677
ChainiPRO_00000194711 – 259Neuregulin-1By similarityAdd BLAST259

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi57 ↔ 116By similarity
Glycosylationi124N-linked (GlcNAc...)Sequence analysis1
Glycosylationi130N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi192 ↔ 206By similarity
Disulfide bondi200 ↔ 220By similarity
Disulfide bondi222 ↔ 231By similarity

Post-translational modificationi

Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.
Extensive glycosylation precedes the proteolytic cleavage.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Expressioni

Tissue specificityi

Isoform alpha1 is expressed in brain and muscle. Isoform CRD is expressed in brain and spinal cord, but at very low level in muscle.

Developmental stagei

Strong expression in developing brain and spinal cord of the embryo. Also expressed in the myotomal muscle.

Structurei

3D structure databases

ProteinModelPortaliO93383.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini37 – 132Ig-like C2-typeAdd BLAST96
Domaini188 – 232EGF-likePROSITE-ProRule annotationAdd BLAST45

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1 – 25Lys-richAdd BLAST25

Domaini

The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization (By similarity).By similarity
ERBB receptor binding is elicited entirely by the EGF-like domain.

Sequence similaritiesi

Belongs to the neuregulin family.Curated
Contains 1 EGF-like domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

HOVERGENiHBG006531.
KOiK05455.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR002154. Neuregulin_C.
IPR018250. NRG1.
[Graphical view]
PANTHERiPTHR11100:SF7. PTHR11100:SF7. 1 hit.
PfamiPF07679. I-set. 1 hit.
PF02158. Neuregulin. 1 hit.
[Graphical view]
PRINTSiPR01089. NEUREGULIN.
SMARTiSM00181. EGF. 1 hit.
SM00409. IG. 1 hit.
SM00408. IGc2. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS00022. EGF_1. 1 hit.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 1 hit.
PS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist. Isoforms have alpha-or beta-type EGF-like domains.
Isoform Alpha1 (identifier: O93383-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEKKKVKEG KGRKGKGKKD RKGKKAEGSD QGAAASPKLK EIKTQSVQEG
60 70 80 90 100
KKLVLKCQAV SEQPSLKFRW FKGEKEIGAK NKPDSKPEHI KIRGKKKSSE
110 120 130 140 150
LQISKASSAD NGEYKCMVSN QLGNDTVTVN VTIVPKPTYN HLLLMKIYLK
160 170 180 190 200
VTSVEKSVEP STLNLLESQK EVIFATTKRG DTTAGPGHLI KCSDKEKTYC
210 220 230 240 250
VNGGECYVLN GITSSNQFMC KCKPGFTGAR CTETDPLRVV RSEKHLGIEF
260 270 280 290 300
MEAEELYQKR VLTITGICID LLVVGDMCVV DAYCKTKKQR KKLNDRLRQS
310 320 330 340 350
LRERNKNITN KDNRPHNPKN PPPRKNVQLV NQYVSKNVIS SEHVIERETE
360 370 380 390 400
TSFSTSHYTS TTHHSTTVTQ TPSHSWSNGL SESMISEKSY SVIVTSSVEN
410 420 430 440 450
SRHTSPTGPR GRLNGIGGPR DCSYLRHARD TPDSYRDSPH SERYVSAMTT
460 470 480 490 500
PARMSPVEFK TPISPKSPCL ETSPPESSLA VSVPSVAVSP FIEEERPLLL
510 520 530 540 550
VSPPRLREKR YDRKTPQKTP HKQHNSYHHN PGHDSSSLPP NPLRIVEDEE
560 570 580 590 600
YETTQEYEPS LEPAKKLVNS RRQKRTKPNG HISNRLELDS DSSSESSTSE
610 620 630 640 650
SETEDERIGE ETPFLSIQNP LAASLESASL YRHADSRTNP TSRFSTQEEL
660 670
QARLSSIANQ ALCDQKKRKM TCKTLFI
Length:677
Mass (Da):75,795
Last modified:November 1, 1998 - v1
Checksum:i49279E8F5BAE396F
GO
Isoform CRD (identifier: O93383-2) [UniParc]FASTAAdd to basket
Also known as: CRD-NRG1, Cysteine-rich domain

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: MAEKKKVKEG...VTVNVTIVPK → MSEDTAEGLQ...KFGTSLLPTE
     223-252: KPGFTGARCTETDPLRVVRSEKHLGIEFME → PNEFTGDRCQNYVMASFYK

Show »
Length:688
Mass (Da):76,968
Checksum:i9D7268A08F5CC89B
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0034491 – 136MAEKK…TIVPK → MSEDTAEGLQNQCSEQSSDP PSAELQNEESMPETQDEEET THGITGLAITCCVCLEADRL RICLNSEKICIIPILACLIS LCLCIAGLKWVFVDKIFEYD SPTHLDPGHRGQDLILYTDT APSTLVPSSVRTLPVIIPTT DSKAAVTFKFGTSLLPTE in isoform CRD. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_003450223 – 252KPGFT…IEFME → PNEFTGDRCQNYVMASFYK in isoform CRD. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF076618 mRNA. Translation: AAC26804.1.
AF142632 mRNA. Translation: AAD33893.1.
RefSeqiNP_001079063.1. NM_001085594.1. [O93383-2]
UniGeneiXl.289.

Genome annotation databases

GeneIDi373595.
KEGGixla:373595.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF076618 mRNA. Translation: AAC26804.1.
AF142632 mRNA. Translation: AAD33893.1.
RefSeqiNP_001079063.1. NM_001085594.1. [O93383-2]
UniGeneiXl.289.

3D structure databases

ProteinModelPortaliO93383.
ModBaseiSearch...
MobiDBiSearch...

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi373595.
KEGGixla:373595.

Organism-specific databases

CTDi3084.
XenbaseiXB-GENE-1011454. nrg1.

Phylogenomic databases

HOVERGENiHBG006531.
KOiK05455.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR002154. Neuregulin_C.
IPR018250. NRG1.
[Graphical view]
PANTHERiPTHR11100:SF7. PTHR11100:SF7. 1 hit.
PfamiPF07679. I-set. 1 hit.
PF02158. Neuregulin. 1 hit.
[Graphical view]
PRINTSiPR01089. NEUREGULIN.
SMARTiSM00181. EGF. 1 hit.
SM00409. IG. 1 hit.
SM00408. IGc2. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS00022. EGF_1. 1 hit.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 1 hit.
PS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNRG1_XENLA
AccessioniPrimary (citable) accession number: O93383
Secondary accession number(s): Q9W6N0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1998
Last modified: October 5, 2016
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.