O88998 (NOE1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Noelin Alternative name(s): Neuronal olfactomedin-related ER localized protein Olfactomedin-1 Pancortin | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 485 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play an important role in regulating the production of neural crest cells by the neural tube By similarity. |
| Subunit structure | Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing. Ref.5 |
| Subcellular location | Secreted Potential. Cell junction › synapse Probable Ref.5. |
| Tissue specificity | Expressed in the brain (at protein level). Ref.5 |
| Sequence similarities | Contains 1 olfactomedin-like domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Secreted Synapse |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Signal |
| Molecular function | Developmental protein |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | multicellular organismal development Inferred from electronic annotation. Source: UniProtKB-KW protein oligomerizationInferred from direct assay PubMed 15927402. Source: MGI |
| Cellular_component | alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Inferred from direct assay Ref.5. Source: MGI cell junctionInferred from electronic annotation. Source: UniProtKB-KW extracellular regionInferred from electronic annotation. Source: UniProtKB-SubCell extracellular spaceInferred from direct assay PubMed 15927402. Source: MGI synapseInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O88998-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O88998-2) The sequence of this isoform differs from the canonical sequence as follows: 153-153: A → G 154-485: Missing. | ||||||
| Isoform 3 (identifier: O88998-3) The sequence of this isoform differs from the canonical sequence as follows: 1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ | ||||||
| Isoform 4 (identifier: O88998-4) Also known as: AMY; The sequence of this isoform differs from the canonical sequence as follows: 1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ 153-153: A → G 154-485: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 16 | 16 | Potential | ||||||||
| Chain | 17 – 485 | 469 | Noelin | PRO_0000020075 | |||||||
Regions | |||||||||||
| Domain | 226 – 478 | 253 | Olfactomedin-like | ||||||||
| Coiled coil | 87 – 225 | 139 | Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 33 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 103 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 187 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 288 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 307 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 394 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 431 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 473 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 227 ↔ 409 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 50 | 50 | MSVPL…DRSTG → MQPARKLLSLLVLLVMGTEL TQ in isoform 3 and isoform 4. | VSP_003762 | |||||||
| Alternative sequence | 153 | 1 | A → G in isoform 2 and isoform 4. | VSP_003763 | |||||||
| Alternative sequence | 154 – 485 | 332 | Missing in isoform 2 and isoform 4. | VSP_003764 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 69 | 1 | S → M in AAB84058. Ref.2 | ||||||||
| Sequence conflict | 329 | 1 | A → M in AAB84058. Ref.2 | ||||||||
| Sequence conflict | 429 | 1 | Q → R in AAB84058. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D78262 mRNA. Translation: BAA28765.1. D78263 mRNA. Translation: BAA28766.1. D78264 mRNA. Translation: BAA28767.1. D78265 mRNA. Translation: BAA28764.1. AF028740 mRNA. Translation: AAB84058.1. AK003031 mRNA. Translation: BAB22520.1. AL731778 Genomic DNA. Translation: CAM46249.1. |
| IPI | IPI00129227. IPI00136712. IPI00225046. IPI00267253. |
| RefSeq | NP_001033701.1. NM_001038612.1. NP_001033703.1. NM_001038614.1. |
| UniGene | Mm.43278. |
3D structure databases | |
| ProteinModelPortal | O88998. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O88998. 1 interaction. |
PTM databases | |
| PhosphoSite | O88998. |
Proteomic databases | |
| PaxDb | O88998. |
| PRIDE | O88998. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000102879; ENSMUSP00000099943; ENSMUSG00000026833. |
| GeneID | 56177. |
| KEGG | mmu:56177. |
| UCSC | uc008iya.1. mouse. uc008iyc.1. mouse. |
Organism-specific databases | |
| CTD | 10439. |
| MGI | MGI:1860437. Olfm1. |
Phylogenomic databases | |
| eggNOG | NOG283888. |
| GeneTree | ENSGT00660000095208. |
| HOVERGEN | HBG006513. |
| InParanoid | O88998. |
| OrthoDB | EOG46MBJC. |
Gene expression databases | |
| ArrayExpress | O88998. |
| Bgee | O88998. |
| CleanEx | MM_OLFM1. |
| Genevestigator | O88998. |
| GermOnline | ENSMUSG00000026833. Mus musculus. |
Family and domain databases | |
| InterPro | IPR022082. Noelin-1. IPR003112. Olfac-like. [Graphical view] |
| Pfam | PF12308. Noelin-1. 1 hit. PF02191. OLF. 1 hit. [Graphical view] |
| SMART | SM00284. OLF. 1 hit. [Graphical view] |
| PROSITE | PS00014. ER_TARGET. 1 hit. PS51132. OLF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | OLFM1. mouse. |
| NextBio | 311952. |
| SOURCE | Search... |
Entry information
| Entry name | NOE1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O88998 Secondary accession number(s): A3KGE5 Q9QWR0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
