Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O88998

- NOE1_MOUSE

UniProt

O88998 - NOE1_MOUSE

Protein

Noelin

Gene

Olfm1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 119 (01 Oct 2014)
      Sequence version 1 (01 Nov 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play an important role in regulating the production of neural crest cells by the neural tube.By similarity

    GO - Molecular functioni

    1. beta-amyloid binding Source: MGI
    2. protein binding Source: MGI

    GO - Biological processi

    1. negative regulation of beta-amyloid formation Source: MGI
    2. negative regulation of neuron migration Source: MGI
    3. protein oligomerization Source: MGI
    4. regulation of beta-amyloid formation Source: MGI

    Keywords - Molecular functioni

    Developmental protein

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Noelin
    Alternative name(s):
    Neuronal olfactomedin-related ER localized protein
    Olfactomedin-1
    Pancortin
    Gene namesi
    Name:Olfm1
    Synonyms:Noe1, Noel, Noel1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:1860437. Olfm1.

    Subcellular locationi

    Secreted Curated. Cell junctionsynapse 1 Publication

    GO - Cellular componenti

    1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: MGI
    2. cell junction Source: UniProtKB-KW
    3. extracellular space Source: MGI
    4. synapse Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Secreted, Synapse

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1616Sequence AnalysisAdd
    BLAST
    Chaini17 – 485469NoelinPRO_0000020075Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi33 – 331N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi103 – 1031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi187 – 1871N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi227 ↔ 409PROSITE-ProRule annotation
    Glycosylationi288 – 2881N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi307 – 3071N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi394 – 3941N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi431 – 4311N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi473 – 4731N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiO88998.
    PaxDbiO88998.
    PRIDEiO88998.

    PTM databases

    PhosphoSiteiO88998.

    Expressioni

    Tissue specificityi

    Expressed in the brain (at protein level).1 Publication

    Gene expression databases

    ArrayExpressiO88998.
    BgeeiO88998.
    CleanExiMM_OLFM1.
    GenevestigatoriO88998.

    Interactioni

    Subunit structurei

    Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing.1 Publication

    Protein-protein interaction databases

    BioGridi207823. 1 interaction.
    IntActiO88998. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliO88998.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini226 – 478253Olfactomedin-likePROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili87 – 225139Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Signal

    Phylogenomic databases

    eggNOGiNOG283888.
    GeneTreeiENSGT00750000117256.
    HOVERGENiHBG006513.
    InParanoidiO88998.
    PhylomeDBiO88998.

    Family and domain databases

    InterProiIPR022082. Noelin-1.
    IPR003112. Olfac-like.
    IPR011044. Quino_amine_DH_bsu.
    [Graphical view]
    PfamiPF12308. Noelin-1. 1 hit.
    PF02191. OLF. 1 hit.
    [Graphical view]
    SMARTiSM00284. OLF. 1 hit.
    [Graphical view]
    SUPFAMiSSF50969. SSF50969. 2 hits.
    PROSITEiPS00014. ER_TARGET. 1 hit.
    PS51132. OLF. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O88998-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTRLSAA SGGTLDRSTG    50
    VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK 100
    VQNMSQSIEV LDRRTQRDLQ YVEKMENQMK GLETKFKQVE ESHKQHLARQ 150
    FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG 200
    AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK TSGSRFGSWM 250
    TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG 300
    TGQVVYNGSI YFNKFQSHII IRFDLKTEAI LKTRSLDYAG YNNMYHYAWG 350
    GHSDIDLMVD ENGLWAVYAT NQNAGNIVIS KLDPVSLQIL QTWNTSYPKR 400
    SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS 450
    MLDYNPKDRA LYAWNNGHQT LYNVTLFHVI RSDEL 485
    Length:485
    Mass (Da):55,398
    Last modified:November 1, 1998 - v1
    Checksum:i6429574ECD814944
    GO
    Isoform 2 (identifier: O88998-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         153-153: A → G
         154-485: Missing.

    Show »
    Length:153
    Mass (Da):17,232
    Checksum:iC47571A8DCAE09E9
    GO
    Isoform 3 (identifier: O88998-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ

    Show »
    Length:457
    Mass (Da):52,674
    Checksum:iCA2AD328E37A0F16
    GO
    Isoform 4 (identifier: O88998-4) [UniParc]FASTAAdd to Basket

    Also known as: AMY

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ
         153-153: A → G
         154-485: Missing.

    Show »
    Length:125
    Mass (Da):14,508
    Checksum:i6EE703826C61DF78
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti69 – 691S → M in AAB84058. 1 PublicationCurated
    Sequence conflicti329 – 3291A → M in AAB84058. 1 PublicationCurated
    Sequence conflicti429 – 4291Q → R in AAB84058. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5050MSVPL…DRSTG → MQPARKLLSLLVLLVMGTEL TQ in isoform 3 and isoform 4. 2 PublicationsVSP_003762Add
    BLAST
    Alternative sequencei153 – 1531A → G in isoform 2 and isoform 4. 1 PublicationVSP_003763
    Alternative sequencei154 – 485332Missing in isoform 2 and isoform 4. 1 PublicationVSP_003764Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D78262 mRNA. Translation: BAA28765.1.
    D78263 mRNA. Translation: BAA28766.1.
    D78264 mRNA. Translation: BAA28767.1.
    D78265 mRNA. Translation: BAA28764.1.
    AF028740 mRNA. Translation: AAB84058.1.
    AK003031 mRNA. Translation: BAB22520.1.
    AL731778 Genomic DNA. Translation: CAM46249.1.
    CCDSiCCDS15833.1. [O88998-3]
    CCDS15834.1. [O88998-1]
    CCDS15835.1. [O88998-2]
    RefSeqiNP_001033701.1. NM_001038612.1. [O88998-2]
    NP_001033703.1. NM_001038614.1. [O88998-4]
    UniGeneiMm.43278.

    Genome annotation databases

    EnsembliENSMUST00000102879; ENSMUSP00000099943; ENSMUSG00000026833. [O88998-2]
    GeneIDi56177.
    KEGGimmu:56177.
    UCSCiuc008iya.1. mouse. [O88998-4]
    uc008iyc.1. mouse. [O88998-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D78262 mRNA. Translation: BAA28765.1 .
    D78263 mRNA. Translation: BAA28766.1 .
    D78264 mRNA. Translation: BAA28767.1 .
    D78265 mRNA. Translation: BAA28764.1 .
    AF028740 mRNA. Translation: AAB84058.1 .
    AK003031 mRNA. Translation: BAB22520.1 .
    AL731778 Genomic DNA. Translation: CAM46249.1 .
    CCDSi CCDS15833.1. [O88998-3 ]
    CCDS15834.1. [O88998-1 ]
    CCDS15835.1. [O88998-2 ]
    RefSeqi NP_001033701.1. NM_001038612.1. [O88998-2 ]
    NP_001033703.1. NM_001038614.1. [O88998-4 ]
    UniGenei Mm.43278.

    3D structure databases

    ProteinModelPortali O88998.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 207823. 1 interaction.
    IntActi O88998. 1 interaction.

    PTM databases

    PhosphoSitei O88998.

    Proteomic databases

    MaxQBi O88998.
    PaxDbi O88998.
    PRIDEi O88998.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000102879 ; ENSMUSP00000099943 ; ENSMUSG00000026833 . [O88998-2 ]
    GeneIDi 56177.
    KEGGi mmu:56177.
    UCSCi uc008iya.1. mouse. [O88998-4 ]
    uc008iyc.1. mouse. [O88998-2 ]

    Organism-specific databases

    CTDi 10439.
    MGIi MGI:1860437. Olfm1.

    Phylogenomic databases

    eggNOGi NOG283888.
    GeneTreei ENSGT00750000117256.
    HOVERGENi HBG006513.
    InParanoidi O88998.
    PhylomeDBi O88998.

    Miscellaneous databases

    ChiTaRSi OLFM1. mouse.
    NextBioi 311952.
    PROi O88998.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O88998.
    Bgeei O88998.
    CleanExi MM_OLFM1.
    Genevestigatori O88998.

    Family and domain databases

    InterProi IPR022082. Noelin-1.
    IPR003112. Olfac-like.
    IPR011044. Quino_amine_DH_bsu.
    [Graphical view ]
    Pfami PF12308. Noelin-1. 1 hit.
    PF02191. OLF. 1 hit.
    [Graphical view ]
    SMARTi SM00284. OLF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50969. SSF50969. 2 hits.
    PROSITEi PS00014. ER_TARGET. 1 hit.
    PS51132. OLF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Differentially expressed olfactomedin-related glycoproteins (Pancortins) in the brain."
      Nagano T., Nakamura A., Mori Y., Maeda M., Takami T., Shiosaka S., Takagi H., Sato M.
      Brain Res. Mol. Brain Res. 53:13-23(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
      Strain: ICR.
      Tissue: Brain.
    2. Anholt R., Kulkarni N., Karavanich C.
      Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Strain: C57BL/6J.
      Tissue: Brain.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. "High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes."
      Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B.
      Neuron 74:621-633(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiNOE1_MOUSE
    AccessioniPrimary (citable) accession number: O88998
    Secondary accession number(s): A3KGE5
    , O35429, O88999, Q91XK8, Q9QWQ9, Q9QWR0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 21, 2001
    Last sequence update: November 1, 1998
    Last modified: October 1, 2014
    This is version 119 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3