Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O88998

- NOE1_MOUSE

UniProt

O88998 - NOE1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Noelin

Gene

Olfm1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play an important role in regulating the production of neural crest cells by the neural tube.By similarity

GO - Molecular functioni

  1. beta-amyloid binding Source: MGI

GO - Biological processi

  1. negative regulation of beta-amyloid formation Source: MGI
  2. negative regulation of neuron migration Source: MGI
  3. protein oligomerization Source: MGI
  4. regulation of beta-amyloid formation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin
Alternative name(s):
Neuronal olfactomedin-related ER localized protein
Olfactomedin-1
Pancortin
Gene namesi
Name:Olfm1
Synonyms:Noe1, Noel, Noel1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:1860437. Olfm1.

Subcellular locationi

Secreted Curated. Cell junctionsynapse 1 Publication

GO - Cellular componenti

  1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: MGI
  2. cell junction Source: UniProtKB-KW
  3. extracellular space Source: MGI
  4. synapse Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Secreted, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616Sequence AnalysisAdd
BLAST
Chaini17 – 485469NoelinPRO_0000020075Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi33 – 331N-linked (GlcNAc...)Sequence Analysis
Glycosylationi103 – 1031N-linked (GlcNAc...)Sequence Analysis
Glycosylationi187 – 1871N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi227 ↔ 409PROSITE-ProRule annotation
Glycosylationi288 – 2881N-linked (GlcNAc...)Sequence Analysis
Glycosylationi307 – 3071N-linked (GlcNAc...)Sequence Analysis
Glycosylationi394 – 3941N-linked (GlcNAc...)Sequence Analysis
Glycosylationi431 – 4311N-linked (GlcNAc...)Sequence Analysis
Glycosylationi473 – 4731N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiO88998.
PaxDbiO88998.
PRIDEiO88998.

PTM databases

PhosphoSiteiO88998.

Expressioni

Tissue specificityi

Expressed in the brain (at protein level).1 Publication

Gene expression databases

BgeeiO88998.
CleanExiMM_OLFM1.
ExpressionAtlasiO88998. baseline and differential.
GenevestigatoriO88998.

Interactioni

Subunit structurei

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing.1 Publication

Protein-protein interaction databases

BioGridi207823. 1 interaction.
IntActiO88998. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliO88998.
SMRiO88998. Positions 92-138.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini226 – 478253Olfactomedin-likePROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili87 – 225139Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiNOG283888.
GeneTreeiENSGT00760000119005.
HOVERGENiHBG006513.
InParanoidiO88998.
PhylomeDBiO88998.

Family and domain databases

InterProiIPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 2 hits.
PROSITEiPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O88998) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTRLSAA SGGTLDRSTG
60 70 80 90 100
VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK
110 120 130 140 150
VQNMSQSIEV LDRRTQRDLQ YVEKMENQMK GLETKFKQVE ESHKQHLARQ
160 170 180 190 200
FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG
210 220 230 240 250
AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK TSGSRFGSWM
260 270 280 290 300
TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG
310 320 330 340 350
TGQVVYNGSI YFNKFQSHII IRFDLKTEAI LKTRSLDYAG YNNMYHYAWG
360 370 380 390 400
GHSDIDLMVD ENGLWAVYAT NQNAGNIVIS KLDPVSLQIL QTWNTSYPKR
410 420 430 440 450
SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS
460 470 480
MLDYNPKDRA LYAWNNGHQT LYNVTLFHVI RSDEL
Length:485
Mass (Da):55,398
Last modified:November 1, 1998 - v1
Checksum:i6429574ECD814944
GO
Isoform 2 (identifier: O88998-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     153-153: A → G
     154-485: Missing.

Show »
Length:153
Mass (Da):17,232
Checksum:iC47571A8DCAE09E9
GO
Isoform 3 (identifier: O88998-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ

Show »
Length:457
Mass (Da):52,674
Checksum:iCA2AD328E37A0F16
GO
Isoform 4 (identifier: O88998-4) [UniParc]FASTAAdd to Basket

Also known as: AMY

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ
     153-153: A → G
     154-485: Missing.

Show »
Length:125
Mass (Da):14,508
Checksum:i6EE703826C61DF78
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti69 – 691S → M in AAB84058. 1 PublicationCurated
Sequence conflicti329 – 3291A → M in AAB84058. 1 PublicationCurated
Sequence conflicti429 – 4291Q → R in AAB84058. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5050MSVPL…DRSTG → MQPARKLLSLLVLLVMGTEL TQ in isoform 3 and isoform 4. 2 PublicationsVSP_003762Add
BLAST
Alternative sequencei153 – 1531A → G in isoform 2 and isoform 4. 1 PublicationVSP_003763
Alternative sequencei154 – 485332Missing in isoform 2 and isoform 4. 1 PublicationVSP_003764Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D78262 mRNA. Translation: BAA28765.1.
D78263 mRNA. Translation: BAA28766.1.
D78264 mRNA. Translation: BAA28767.1.
D78265 mRNA. Translation: BAA28764.1.
AF028740 mRNA. Translation: AAB84058.1.
AK003031 mRNA. Translation: BAB22520.1.
AL731778 Genomic DNA. Translation: CAM46249.1.
CCDSiCCDS15833.1. [O88998-3]
CCDS15834.1. [O88998-1]
CCDS15835.1. [O88998-2]
RefSeqiNP_001033701.1. NM_001038612.1. [O88998-2]
NP_001033703.1. NM_001038614.1. [O88998-4]
UniGeneiMm.43278.

Genome annotation databases

EnsembliENSMUST00000102879; ENSMUSP00000099943; ENSMUSG00000026833. [O88998-2]
GeneIDi56177.
KEGGimmu:56177.
UCSCiuc008iya.1. mouse. [O88998-4]
uc008iyc.1. mouse. [O88998-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D78262 mRNA. Translation: BAA28765.1 .
D78263 mRNA. Translation: BAA28766.1 .
D78264 mRNA. Translation: BAA28767.1 .
D78265 mRNA. Translation: BAA28764.1 .
AF028740 mRNA. Translation: AAB84058.1 .
AK003031 mRNA. Translation: BAB22520.1 .
AL731778 Genomic DNA. Translation: CAM46249.1 .
CCDSi CCDS15833.1. [O88998-3 ]
CCDS15834.1. [O88998-1 ]
CCDS15835.1. [O88998-2 ]
RefSeqi NP_001033701.1. NM_001038612.1. [O88998-2 ]
NP_001033703.1. NM_001038614.1. [O88998-4 ]
UniGenei Mm.43278.

3D structure databases

ProteinModelPortali O88998.
SMRi O88998. Positions 92-138.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 207823. 1 interaction.
IntActi O88998. 1 interaction.

PTM databases

PhosphoSitei O88998.

Proteomic databases

MaxQBi O88998.
PaxDbi O88998.
PRIDEi O88998.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000102879 ; ENSMUSP00000099943 ; ENSMUSG00000026833 . [O88998-2 ]
GeneIDi 56177.
KEGGi mmu:56177.
UCSCi uc008iya.1. mouse. [O88998-4 ]
uc008iyc.1. mouse. [O88998-2 ]

Organism-specific databases

CTDi 10439.
MGIi MGI:1860437. Olfm1.

Phylogenomic databases

eggNOGi NOG283888.
GeneTreei ENSGT00760000119005.
HOVERGENi HBG006513.
InParanoidi O88998.
PhylomeDBi O88998.

Miscellaneous databases

ChiTaRSi OLFM1. mouse.
NextBioi 311952.
PROi O88998.
SOURCEi Search...

Gene expression databases

Bgeei O88998.
CleanExi MM_OLFM1.
ExpressionAtlasi O88998. baseline and differential.
Genevestigatori O88998.

Family and domain databases

InterProi IPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view ]
Pfami PF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view ]
SMARTi SM00284. OLF. 1 hit.
[Graphical view ]
SUPFAMi SSF50969. SSF50969. 2 hits.
PROSITEi PS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Differentially expressed olfactomedin-related glycoproteins (Pancortins) in the brain."
    Nagano T., Nakamura A., Mori Y., Maeda M., Takami T., Shiosaka S., Takagi H., Sato M.
    Brain Res. Mol. Brain Res. 53:13-23(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
    Strain: ICR.
    Tissue: Brain.
  2. Anholt R., Kulkarni N., Karavanich C.
    Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Strain: C57BL/6J.
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. "High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes."
    Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B.
    Neuron 74:621-633(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiNOE1_MOUSE
AccessioniPrimary (citable) accession number: O88998
Secondary accession number(s): A3KGE5
, O35429, O88999, Q91XK8, Q9QWQ9, Q9QWR0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: November 1, 1998
Last modified: October 29, 2014
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3