Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O88803 (LECT2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 102. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Leukocyte cell-derived chemotaxin-2

Short name=LECT-2
Alternative name(s):
Chondromodulin II
Short name=ChM-II
Gene names
Name:Lect2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length151 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Has a neutrophil chemotactic activity. Also a positive regulator of chondrocyte proliferation.

Subcellular location

Secreted.

Tissue specificity

Highly expressed in liver and weakly in testis. Not expressed in heart, brain, spleen, lung, skeletal muscle and kidney.

Sequence similarities

Belongs to the LECT2/MIM-1 family.

Ontologies

Keywords
   Biological processChemotaxis
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
   DomainSignal
   PTMDisulfide bond
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processchemotaxis

Inferred from electronic annotation. Source: UniProtKB-KW

negative regulation of Wnt signaling pathway

Inferred from direct assay PubMed 18644872. Source: MGI

   Cellular_componentextracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionidentical protein binding

Inferred from physical interaction PubMed 23352894. Source: IntAct

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

itself8EBI-8307190,EBI-8307190

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O88803-1)

Also known as: LECT2;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O88803-2)

Also known as: LECT2Q;

The sequence of this isoform differs from the canonical sequence as follows:
     98-151: FCVKIFYIKP...CDSSDPTAYL → QRLQAHTTTLNVFTCYWDKIQIPRPTRFLCQNFLH

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1818 By similarity
Chain19 – 151133Leukocyte cell-derived chemotaxin-2
PRO_0000017365

Amino acid modifications

Disulfide bond25 ↔ 60 Ref.6
Disulfide bond36 ↔ 41 Ref.6
Disulfide bond99 ↔ 142 Ref.6

Natural variations

Alternative sequence98 – 15154FCVKI…PTAYL → QRLQAHTTTLNVFTCYWDKI QIPRPTRFLCQNFLH in isoform 2.
VSP_003051
Natural variant1291I → V. Ref.1 Ref.3 Ref.4 Ref.5

Experimental info

Sequence conflict1001V → F in AAH27753. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (LECT2) [UniParc].

Last modified November 1, 1998. Version 1.
Checksum: 18AF444046B7AE8E

FASTA15116,405
        10         20         30         40         50         60 
MIPTTILISA ALLSSALAGP WANICASKSS NEIRTCDSYG CGQYSAQRTQ RHHPGVDVLC 

        70         80         90        100        110        120 
SDGSVVYAPF TGKIVGQEKP YRNKNAINDG IRLSGRGFCV KIFYIKPIKY KGSIKKGEKL 

       130        140        150 
GTLLPLQKIY PGIQSHVHVE NCDSSDPTAY L 

« Hide

Isoform 2 (LECT2Q) [UniParc].

Checksum: 8676B861E7AF6102
Show »

FASTA13214,586

References

« Hide 'large scale' references
[1]"The mouse Lect2 gene: cloning of cDNA and genomic DNA, structural characterization and chromosomal localization."
Yamagoe S., Watanabe T., Mizuno S., Suzuki K.
Gene 216:171-178(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-129.
Strain: BALB/c.
Tissue: Liver.
[2]"Molecular cloning of mouse and bovine chondromodulin-II cDNAs and the growth-promoting actions of bovine recombinant protein."
Shukunami C., Kondo J., Wakai H., Takahashi K., Inoue H., Kamizono A., Hiraki Y.
J. Biochem. 125:436-442(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: Swiss Webster / NIH.
Tissue: Embryo and Liver.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-129.
Strain: C57BL/6J.
Tissue: Liver.
[4]Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-129.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-129.
Strain: FVB/N.
Tissue: Liver.
[6]"Identification and assignment of three disulfide bonds in mammalian leukocyte cell-derived chemotaxin 2 by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry."
Okumura A., Suzuki T., Dohmae N., Okabe T., Hashimoto Y., Nakazato K., Ohno H., Miyazaki Y., Yamagoe S.
Biosci. Trends 3:139-143(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: DISULFIDE BONDS.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB009687 mRNA. Translation: BAA33383.1.
AB009688 mRNA. Translation: BAA33384.1.
AB009689 Genomic DNA. Translation: BAA33385.1.
AB009689 Genomic DNA. Translation: BAA33386.1.
AF035161 mRNA. Translation: AAF13302.1.
AK131971 mRNA. Translation: BAE20911.1.
CH466546 Genomic DNA. Translation: EDL41242.1.
BC027753 mRNA. Translation: AAH27753.1.
CCDSCCDS26564.1. [O88803-1]
RefSeqNP_034832.2. NM_010702.2.
UniGeneMm.16973.

3D structure databases

ProteinModelPortalO88803.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

MINTMINT-8408925.

PTM databases

PhosphoSiteO88803.

Proteomic databases

PaxDbO88803.
PRIDEO88803.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000062806; ENSMUSP00000060495; ENSMUSG00000021539.
GeneID16841.
KEGGmmu:16841.
UCSCuc007qst.2. mouse. [O88803-1]
uc011zad.1. mouse. [O88803-2]

Organism-specific databases

CTD3950.
MGIMGI:1278342. Lect2.

Phylogenomic databases

eggNOGNOG45864.
GeneTreeENSGT00390000015484.
HOGENOMHOG000113312.
HOVERGENHBG052320.
InParanoidQ8K181.
OrthoDBEOG7K6PWV.
PhylomeDBO88803.
TreeFamTF331097.

Gene expression databases

BgeeO88803.
CleanExMM_LECT2.
GenevestigatorO88803.

Family and domain databases

InterProIPR008663. LECT2.
IPR017381. LECT2_chordata.
IPR016047. Peptidase_M23.
[Graphical view]
PANTHERPTHR11329. PTHR11329. 1 hit.
PfamPF01551. Peptidase_M23. 1 hit.
[Graphical view]
PIRSFPIRSF038085. LECT3. 1 hit.
ProtoNetSearch...

Other

NextBio290764.
PROO88803.
SOURCESearch...

Entry information

Entry nameLECT2_MOUSE
AccessionPrimary (citable) accession number: O88803
Secondary accession number(s): O88804 expand/collapse secondary AC list , Q3V287, Q8K181, Q9QWN3, Q9Z337
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: July 9, 2014
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot