SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O88803

- LECT2_MOUSE

UniProt

O88803 - LECT2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Leukocyte cell-derived chemotaxin-2

Gene
Lect2
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Has a neutrophil chemotactic activity. Also a positive regulator of chondrocyte proliferation.

GO - Molecular functioni

  1. identical protein binding Source: IntAct

GO - Biological processi

  1. chemotaxis Source: UniProtKB-KW
  2. negative regulation of Wnt signaling pathway Source: MGI
Complete GO annotation...

Keywords - Biological processi

Chemotaxis

Names & Taxonomyi

Protein namesi
Recommended name:
Leukocyte cell-derived chemotaxin-2
Short name:
LECT-2
Alternative name(s):
Chondromodulin II
Short name:
ChM-II
Gene namesi
Name:Lect2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 13

Organism-specific databases

MGIiMGI:1278342. Lect2.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818 By similarityAdd
BLAST
Chaini19 – 151133Leukocyte cell-derived chemotaxin-2PRO_0000017365Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi25 ↔ 601 Publication
Disulfide bondi36 ↔ 411 Publication
Disulfide bondi99 ↔ 1421 Publication

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiO88803.
PRIDEiO88803.

PTM databases

PhosphoSiteiO88803.

Expressioni

Tissue specificityi

Highly expressed in liver and weakly in testis. Not expressed in heart, brain, spleen, lung, skeletal muscle and kidney.

Gene expression databases

BgeeiO88803.
CleanExiMM_LECT2.
GenevestigatoriO88803.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
itself8EBI-8307190,EBI-8307190

Protein-protein interaction databases

MINTiMINT-8408925.

Structurei

3D structure databases

ProteinModelPortaliO88803.

Family & Domainsi

Sequence similaritiesi

Belongs to the LECT2/MIM-1 family.

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG45864.
GeneTreeiENSGT00390000015484.
HOGENOMiHOG000113312.
HOVERGENiHBG052320.
InParanoidiQ8K181.
OrthoDBiEOG7K6PWV.
PhylomeDBiO88803.
TreeFamiTF331097.

Family and domain databases

InterProiIPR008663. LECT2.
IPR017381. LECT2_chordata.
IPR016047. Peptidase_M23.
[Graphical view]
PANTHERiPTHR11329. PTHR11329. 1 hit.
PfamiPF01551. Peptidase_M23. 1 hit.
[Graphical view]
PIRSFiPIRSF038085. LECT3. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O88803-1) [UniParc]FASTAAdd to Basket

Also known as: LECT2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MIPTTILISA ALLSSALAGP WANICASKSS NEIRTCDSYG CGQYSAQRTQ    50
RHHPGVDVLC SDGSVVYAPF TGKIVGQEKP YRNKNAINDG IRLSGRGFCV 100
KIFYIKPIKY KGSIKKGEKL GTLLPLQKIY PGIQSHVHVE NCDSSDPTAY 150
L 151
Length:151
Mass (Da):16,405
Last modified:November 1, 1998 - v1
Checksum:i18AF444046B7AE8E
GO
Isoform 2 (identifier: O88803-2) [UniParc]FASTAAdd to Basket

Also known as: LECT2Q

The sequence of this isoform differs from the canonical sequence as follows:
     98-151: FCVKIFYIKP...CDSSDPTAYL → QRLQAHTTTLNVFTCYWDKIQIPRPTRFLCQNFLH

Show »
Length:132
Mass (Da):14,586
Checksum:i8676B861E7AF6102
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti129 – 1291I → V.4 Publications

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei98 – 15154FCVKI…PTAYL → QRLQAHTTTLNVFTCYWDKI QIPRPTRFLCQNFLH in isoform 2. VSP_003051Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti100 – 1001V → F in AAH27753. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009687 mRNA. Translation: BAA33383.1.
AB009688 mRNA. Translation: BAA33384.1.
AB009689 Genomic DNA. Translation: BAA33385.1.
AB009689 Genomic DNA. Translation: BAA33386.1.
AF035161 mRNA. Translation: AAF13302.1.
AK131971 mRNA. Translation: BAE20911.1.
CH466546 Genomic DNA. Translation: EDL41242.1.
BC027753 mRNA. Translation: AAH27753.1.
CCDSiCCDS26564.1. [O88803-1]
RefSeqiNP_034832.2. NM_010702.2.
UniGeneiMm.16973.

Genome annotation databases

EnsembliENSMUST00000062806; ENSMUSP00000060495; ENSMUSG00000021539.
GeneIDi16841.
KEGGimmu:16841.
UCSCiuc007qst.2. mouse. [O88803-1]
uc011zad.1. mouse. [O88803-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009687 mRNA. Translation: BAA33383.1 .
AB009688 mRNA. Translation: BAA33384.1 .
AB009689 Genomic DNA. Translation: BAA33385.1 .
AB009689 Genomic DNA. Translation: BAA33386.1 .
AF035161 mRNA. Translation: AAF13302.1 .
AK131971 mRNA. Translation: BAE20911.1 .
CH466546 Genomic DNA. Translation: EDL41242.1 .
BC027753 mRNA. Translation: AAH27753.1 .
CCDSi CCDS26564.1. [O88803-1 ]
RefSeqi NP_034832.2. NM_010702.2.
UniGenei Mm.16973.

3D structure databases

ProteinModelPortali O88803.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

MINTi MINT-8408925.

PTM databases

PhosphoSitei O88803.

Proteomic databases

PaxDbi O88803.
PRIDEi O88803.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000062806 ; ENSMUSP00000060495 ; ENSMUSG00000021539 .
GeneIDi 16841.
KEGGi mmu:16841.
UCSCi uc007qst.2. mouse. [O88803-1 ]
uc011zad.1. mouse. [O88803-2 ]

Organism-specific databases

CTDi 3950.
MGIi MGI:1278342. Lect2.

Phylogenomic databases

eggNOGi NOG45864.
GeneTreei ENSGT00390000015484.
HOGENOMi HOG000113312.
HOVERGENi HBG052320.
InParanoidi Q8K181.
OrthoDBi EOG7K6PWV.
PhylomeDBi O88803.
TreeFami TF331097.

Miscellaneous databases

NextBioi 290764.
PROi O88803.
SOURCEi Search...

Gene expression databases

Bgeei O88803.
CleanExi MM_LECT2.
Genevestigatori O88803.

Family and domain databases

InterProi IPR008663. LECT2.
IPR017381. LECT2_chordata.
IPR016047. Peptidase_M23.
[Graphical view ]
PANTHERi PTHR11329. PTHR11329. 1 hit.
Pfami PF01551. Peptidase_M23. 1 hit.
[Graphical view ]
PIRSFi PIRSF038085. LECT3. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The mouse Lect2 gene: cloning of cDNA and genomic DNA, structural characterization and chromosomal localization."
    Yamagoe S., Watanabe T., Mizuno S., Suzuki K.
    Gene 216:171-178(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-129.
    Strain: BALB/c.
    Tissue: Liver.
  2. "Molecular cloning of mouse and bovine chondromodulin-II cDNAs and the growth-promoting actions of bovine recombinant protein."
    Shukunami C., Kondo J., Wakai H., Takahashi K., Inoue H., Kamizono A., Hiraki Y.
    J. Biochem. 125:436-442(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Swiss Webster / NIH.
    Tissue: Embryo and Liver.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-129.
    Strain: C57BL/6J.
    Tissue: Liver.
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-129.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-129.
    Strain: FVB/N.
    Tissue: Liver.
  6. "Identification and assignment of three disulfide bonds in mammalian leukocyte cell-derived chemotaxin 2 by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry."
    Okumura A., Suzuki T., Dohmae N., Okabe T., Hashimoto Y., Nakazato K., Ohno H., Miyazaki Y., Yamagoe S.
    Biosci. Trends 3:139-143(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISULFIDE BONDS.

Entry informationi

Entry nameiLECT2_MOUSE
AccessioniPrimary (citable) accession number: O88803
Secondary accession number(s): O88804
, Q3V287, Q8K181, Q9QWN3, Q9Z337
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: July 9, 2014
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi