Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leukocyte cell-derived chemotaxin-2

Gene

Lect2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Has a neutrophil chemotactic activity. Also a positive regulator of chondrocyte proliferation.

GO - Molecular functioni

  1. identical protein binding Source: IntAct

GO - Biological processi

  1. chemotaxis Source: UniProtKB-KW
  2. negative regulation of Wnt signaling pathway Source: MGI
Complete GO annotation...

Keywords - Biological processi

Chemotaxis

Names & Taxonomyi

Protein namesi
Recommended name:
Leukocyte cell-derived chemotaxin-2
Short name:
LECT-2
Alternative name(s):
Chondromodulin II
Short name:
ChM-II
Gene namesi
Name:Lect2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:1278342. Lect2.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818By similarityAdd
BLAST
Chaini19 – 151133Leukocyte cell-derived chemotaxin-2PRO_0000017365Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi25 ↔ 601 Publication
Disulfide bondi36 ↔ 411 Publication
Disulfide bondi99 ↔ 1421 Publication

Keywords - PTMi

Disulfide bond

Proteomic databases

MaxQBiO88803.
PaxDbiO88803.
PRIDEiO88803.

PTM databases

PhosphoSiteiO88803.

Expressioni

Tissue specificityi

Highly expressed in liver and weakly in testis. Not expressed in heart, brain, spleen, lung, skeletal muscle and kidney.

Gene expression databases

BgeeiO88803.
CleanExiMM_LECT2.
GenevestigatoriO88803.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
itself8EBI-8307190,EBI-8307190

Protein-protein interaction databases

MINTiMINT-8408925.

Family & Domainsi

Sequence similaritiesi

Belongs to the LECT2/MIM-1 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG45864.
HOGENOMiHOG000113312.
HOVERGENiHBG052320.
InParanoidiO88803.
OrthoDBiEOG7K6PWV.
PhylomeDBiO88803.
TreeFamiTF331097.

Family and domain databases

InterProiIPR008663. LECT2.
IPR017381. LECT2_chordata.
IPR016047. Peptidase_M23.
[Graphical view]
PANTHERiPTHR11329. PTHR11329. 1 hit.
PfamiPF01551. Peptidase_M23. 1 hit.
[Graphical view]
PIRSFiPIRSF038085. LECT3. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O88803-1) [UniParc]FASTAAdd to basket

Also known as: LECT2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIPTTILISA ALLSSALAGP WANICASKSS NEIRTCDSYG CGQYSAQRTQ
60 70 80 90 100
RHHPGVDVLC SDGSVVYAPF TGKIVGQEKP YRNKNAINDG IRLSGRGFCV
110 120 130 140 150
KIFYIKPIKY KGSIKKGEKL GTLLPLQKIY PGIQSHVHVE NCDSSDPTAY

L
Length:151
Mass (Da):16,405
Last modified:November 1, 1998 - v1
Checksum:i18AF444046B7AE8E
GO
Isoform 2 (identifier: O88803-2) [UniParc]FASTAAdd to basket

Also known as: LECT2Q

The sequence of this isoform differs from the canonical sequence as follows:
     98-151: FCVKIFYIKP...CDSSDPTAYL → QRLQAHTTTLNVFTCYWDKIQIPRPTRFLCQNFLH

Show »
Length:132
Mass (Da):14,586
Checksum:i8676B861E7AF6102
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti100 – 1001V → F in AAH27753 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti129 – 1291I → V.4 Publications

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei98 – 15154FCVKI…PTAYL → QRLQAHTTTLNVFTCYWDKI QIPRPTRFLCQNFLH in isoform 2. 1 PublicationVSP_003051Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009687 mRNA. Translation: BAA33383.1.
AB009688 mRNA. Translation: BAA33384.1.
AB009689 Genomic DNA. Translation: BAA33385.1.
AB009689 Genomic DNA. Translation: BAA33386.1.
AF035161 mRNA. Translation: AAF13302.1.
AK131971 mRNA. Translation: BAE20911.1.
CH466546 Genomic DNA. Translation: EDL41242.1.
BC027753 mRNA. Translation: AAH27753.1.
CCDSiCCDS26564.1. [O88803-1]
RefSeqiNP_034832.2. NM_010702.2.
UniGeneiMm.16973.

Genome annotation databases

GeneIDi16841.
KEGGimmu:16841.
UCSCiuc007qst.2. mouse. [O88803-1]
uc011zad.1. mouse. [O88803-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009687 mRNA. Translation: BAA33383.1.
AB009688 mRNA. Translation: BAA33384.1.
AB009689 Genomic DNA. Translation: BAA33385.1.
AB009689 Genomic DNA. Translation: BAA33386.1.
AF035161 mRNA. Translation: AAF13302.1.
AK131971 mRNA. Translation: BAE20911.1.
CH466546 Genomic DNA. Translation: EDL41242.1.
BC027753 mRNA. Translation: AAH27753.1.
CCDSiCCDS26564.1. [O88803-1]
RefSeqiNP_034832.2. NM_010702.2.
UniGeneiMm.16973.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-8408925.

PTM databases

PhosphoSiteiO88803.

Proteomic databases

MaxQBiO88803.
PaxDbiO88803.
PRIDEiO88803.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi16841.
KEGGimmu:16841.
UCSCiuc007qst.2. mouse. [O88803-1]
uc011zad.1. mouse. [O88803-2]

Organism-specific databases

CTDi3950.
MGIiMGI:1278342. Lect2.

Phylogenomic databases

eggNOGiNOG45864.
HOGENOMiHOG000113312.
HOVERGENiHBG052320.
InParanoidiO88803.
OrthoDBiEOG7K6PWV.
PhylomeDBiO88803.
TreeFamiTF331097.

Miscellaneous databases

NextBioi290764.
PROiO88803.
SOURCEiSearch...

Gene expression databases

BgeeiO88803.
CleanExiMM_LECT2.
GenevestigatoriO88803.

Family and domain databases

InterProiIPR008663. LECT2.
IPR017381. LECT2_chordata.
IPR016047. Peptidase_M23.
[Graphical view]
PANTHERiPTHR11329. PTHR11329. 1 hit.
PfamiPF01551. Peptidase_M23. 1 hit.
[Graphical view]
PIRSFiPIRSF038085. LECT3. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The mouse Lect2 gene: cloning of cDNA and genomic DNA, structural characterization and chromosomal localization."
    Yamagoe S., Watanabe T., Mizuno S., Suzuki K.
    Gene 216:171-178(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-129.
    Strain: BALB/c.
    Tissue: Liver.
  2. "Molecular cloning of mouse and bovine chondromodulin-II cDNAs and the growth-promoting actions of bovine recombinant protein."
    Shukunami C., Kondo J., Wakai H., Takahashi K., Inoue H., Kamizono A., Hiraki Y.
    J. Biochem. 125:436-442(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Swiss Webster / NIH.
    Tissue: Embryo and Liver.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-129.
    Strain: C57BL/6J.
    Tissue: Liver.
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-129.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-129.
    Strain: FVB/N.
    Tissue: Liver.
  6. "Identification and assignment of three disulfide bonds in mammalian leukocyte cell-derived chemotaxin 2 by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry."
    Okumura A., Suzuki T., Dohmae N., Okabe T., Hashimoto Y., Nakazato K., Ohno H., Miyazaki Y., Yamagoe S.
    Biosci. Trends 3:139-143(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISULFIDE BONDS.

Entry informationi

Entry nameiLECT2_MOUSE
AccessioniPrimary (citable) accession number: O88803
Secondary accession number(s): O88804
, Q3V287, Q8K181, Q9QWN3, Q9Z337
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: April 1, 2015
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.