Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O88803

- LECT2_MOUSE

UniProt

O88803 - LECT2_MOUSE

Protein

Leukocyte cell-derived chemotaxin-2

Gene

Lect2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Has a neutrophil chemotactic activity. Also a positive regulator of chondrocyte proliferation.

    GO - Molecular functioni

    1. identical protein binding Source: IntAct

    GO - Biological processi

    1. chemotaxis Source: UniProtKB-KW
    2. negative regulation of Wnt signaling pathway Source: MGI

    Keywords - Biological processi

    Chemotaxis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Leukocyte cell-derived chemotaxin-2
    Short name:
    LECT-2
    Alternative name(s):
    Chondromodulin II
    Short name:
    ChM-II
    Gene namesi
    Name:Lect2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 13

    Organism-specific databases

    MGIiMGI:1278342. Lect2.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1818By similarityAdd
    BLAST
    Chaini19 – 151133Leukocyte cell-derived chemotaxin-2PRO_0000017365Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi25 ↔ 601 Publication
    Disulfide bondi36 ↔ 411 Publication
    Disulfide bondi99 ↔ 1421 Publication

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PaxDbiO88803.
    PRIDEiO88803.

    PTM databases

    PhosphoSiteiO88803.

    Expressioni

    Tissue specificityi

    Highly expressed in liver and weakly in testis. Not expressed in heart, brain, spleen, lung, skeletal muscle and kidney.

    Gene expression databases

    BgeeiO88803.
    CleanExiMM_LECT2.
    GenevestigatoriO88803.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself8EBI-8307190,EBI-8307190

    Protein-protein interaction databases

    MINTiMINT-8408925.

    Structurei

    3D structure databases

    ProteinModelPortaliO88803.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the LECT2/MIM-1 family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG45864.
    GeneTreeiENSGT00390000015484.
    HOGENOMiHOG000113312.
    HOVERGENiHBG052320.
    InParanoidiQ8K181.
    OrthoDBiEOG7K6PWV.
    PhylomeDBiO88803.
    TreeFamiTF331097.

    Family and domain databases

    InterProiIPR008663. LECT2.
    IPR017381. LECT2_chordata.
    IPR016047. Peptidase_M23.
    [Graphical view]
    PANTHERiPTHR11329. PTHR11329. 1 hit.
    PfamiPF01551. Peptidase_M23. 1 hit.
    [Graphical view]
    PIRSFiPIRSF038085. LECT3. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O88803-1) [UniParc]FASTAAdd to Basket

    Also known as: LECT2

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIPTTILISA ALLSSALAGP WANICASKSS NEIRTCDSYG CGQYSAQRTQ    50
    RHHPGVDVLC SDGSVVYAPF TGKIVGQEKP YRNKNAINDG IRLSGRGFCV 100
    KIFYIKPIKY KGSIKKGEKL GTLLPLQKIY PGIQSHVHVE NCDSSDPTAY 150
    L 151
    Length:151
    Mass (Da):16,405
    Last modified:November 1, 1998 - v1
    Checksum:i18AF444046B7AE8E
    GO
    Isoform 2 (identifier: O88803-2) [UniParc]FASTAAdd to Basket

    Also known as: LECT2Q

    The sequence of this isoform differs from the canonical sequence as follows:
         98-151: FCVKIFYIKP...CDSSDPTAYL → QRLQAHTTTLNVFTCYWDKIQIPRPTRFLCQNFLH

    Show »
    Length:132
    Mass (Da):14,586
    Checksum:i8676B861E7AF6102
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti100 – 1001V → F in AAH27753. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti129 – 1291I → V.4 Publications

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei98 – 15154FCVKI…PTAYL → QRLQAHTTTLNVFTCYWDKI QIPRPTRFLCQNFLH in isoform 2. 1 PublicationVSP_003051Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009687 mRNA. Translation: BAA33383.1.
    AB009688 mRNA. Translation: BAA33384.1.
    AB009689 Genomic DNA. Translation: BAA33385.1.
    AB009689 Genomic DNA. Translation: BAA33386.1.
    AF035161 mRNA. Translation: AAF13302.1.
    AK131971 mRNA. Translation: BAE20911.1.
    CH466546 Genomic DNA. Translation: EDL41242.1.
    BC027753 mRNA. Translation: AAH27753.1.
    CCDSiCCDS26564.1. [O88803-1]
    RefSeqiNP_034832.2. NM_010702.2.
    UniGeneiMm.16973.

    Genome annotation databases

    EnsembliENSMUST00000062806; ENSMUSP00000060495; ENSMUSG00000021539.
    GeneIDi16841.
    KEGGimmu:16841.
    UCSCiuc007qst.2. mouse. [O88803-1]
    uc011zad.1. mouse. [O88803-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009687 mRNA. Translation: BAA33383.1 .
    AB009688 mRNA. Translation: BAA33384.1 .
    AB009689 Genomic DNA. Translation: BAA33385.1 .
    AB009689 Genomic DNA. Translation: BAA33386.1 .
    AF035161 mRNA. Translation: AAF13302.1 .
    AK131971 mRNA. Translation: BAE20911.1 .
    CH466546 Genomic DNA. Translation: EDL41242.1 .
    BC027753 mRNA. Translation: AAH27753.1 .
    CCDSi CCDS26564.1. [O88803-1 ]
    RefSeqi NP_034832.2. NM_010702.2.
    UniGenei Mm.16973.

    3D structure databases

    ProteinModelPortali O88803.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    MINTi MINT-8408925.

    PTM databases

    PhosphoSitei O88803.

    Proteomic databases

    PaxDbi O88803.
    PRIDEi O88803.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000062806 ; ENSMUSP00000060495 ; ENSMUSG00000021539 .
    GeneIDi 16841.
    KEGGi mmu:16841.
    UCSCi uc007qst.2. mouse. [O88803-1 ]
    uc011zad.1. mouse. [O88803-2 ]

    Organism-specific databases

    CTDi 3950.
    MGIi MGI:1278342. Lect2.

    Phylogenomic databases

    eggNOGi NOG45864.
    GeneTreei ENSGT00390000015484.
    HOGENOMi HOG000113312.
    HOVERGENi HBG052320.
    InParanoidi Q8K181.
    OrthoDBi EOG7K6PWV.
    PhylomeDBi O88803.
    TreeFami TF331097.

    Miscellaneous databases

    NextBioi 290764.
    PROi O88803.
    SOURCEi Search...

    Gene expression databases

    Bgeei O88803.
    CleanExi MM_LECT2.
    Genevestigatori O88803.

    Family and domain databases

    InterProi IPR008663. LECT2.
    IPR017381. LECT2_chordata.
    IPR016047. Peptidase_M23.
    [Graphical view ]
    PANTHERi PTHR11329. PTHR11329. 1 hit.
    Pfami PF01551. Peptidase_M23. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF038085. LECT3. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The mouse Lect2 gene: cloning of cDNA and genomic DNA, structural characterization and chromosomal localization."
      Yamagoe S., Watanabe T., Mizuno S., Suzuki K.
      Gene 216:171-178(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-129.
      Strain: BALB/c.
      Tissue: Liver.
    2. "Molecular cloning of mouse and bovine chondromodulin-II cDNAs and the growth-promoting actions of bovine recombinant protein."
      Shukunami C., Kondo J., Wakai H., Takahashi K., Inoue H., Kamizono A., Hiraki Y.
      J. Biochem. 125:436-442(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: Swiss Webster / NIH.
      Tissue: Embryo and Liver.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-129.
      Strain: C57BL/6J.
      Tissue: Liver.
    4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-129.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-129.
      Strain: FVB/N.
      Tissue: Liver.
    6. "Identification and assignment of three disulfide bonds in mammalian leukocyte cell-derived chemotaxin 2 by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry."
      Okumura A., Suzuki T., Dohmae N., Okabe T., Hashimoto Y., Nakazato K., Ohno H., Miyazaki Y., Yamagoe S.
      Biosci. Trends 3:139-143(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISULFIDE BONDS.

    Entry informationi

    Entry nameiLECT2_MOUSE
    AccessioniPrimary (citable) accession number: O88803
    Secondary accession number(s): O88804
    , Q3V287, Q8K181, Q9QWN3, Q9Z337
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: November 1, 1998
    Last modified: October 1, 2014
    This is version 103 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3