Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF1B

Gene

Kif1b

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility (By similarity).By similarity
Isoform 1 mediates the transport of synaptic vesicles in neuronal cells.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi97 – 1048ATPPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF1B
Gene namesi
Name:Kif1b
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 5

Organism-specific databases

RGDi621520. Kif1b.

Subcellular locationi

  • Cytoplasmic vesicle 1 Publication
  • Cytoplasmcytoskeleton By similarity
  • Mitochondrion By similarity

  • Note: Colocalizes with synaptophysin at synaptic cytoplasmic transport vesicles in the neurites of hippocampal neurons. Isoform 2 is involved in the translocation of lysosomes from perinuclear regions to the cell periphery.

GO - Cellular componenti

  • axon cytoplasm Source: GOC
  • cytoplasmic vesicle Source: UniProtKB
  • cytoplasmic vesicle membrane Source: UniProtKB
  • kinesin complex Source: GO_Central
  • microtubule Source: UniProtKB-KW
  • microtubule associated complex Source: UniProtKB
  • mitochondrion Source: MGI
  • neuron projection Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Microtubule, Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 18161815Kinesin-like protein KIF1BPRO_0000125409Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserineBy similarity
Modified residuei647 – 6471PhosphothreonineBy similarity
Modified residuei652 – 6521PhosphothreonineBy similarity
Modified residuei1054 – 10541PhosphoserineBy similarity
Modified residuei1057 – 10571PhosphoserineCombined sources
Modified residuei1416 – 14161PhosphoserineBy similarity
Modified residuei1454 – 14541PhosphoserineCombined sources
Modified residuei1487 – 14871PhosphoserineCombined sources
Modified residuei1573 – 15731PhosphoserineBy similarity
Modified residuei1603 – 16031PhosphoserineBy similarity
Modified residuei1610 – 16101PhosphoserineBy similarity
Modified residuei1613 – 16131PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiO88658.
PRIDEiO88658.

PTM databases

iPTMnetiO88658.
PhosphoSiteiO88658.

Expressioni

Tissue specificityi

Isoform 1 is expressed in the brain with lower expression in testis and liver (at protein level). Isoform 1 is strongly expressed in the brain and ovary, with lower expression in lung, kidney, uterus, testis and liver. Isoform 2 is expressed in non-neuronal cells.1 Publication

Gene expression databases

ExpressionAtlasiO88658. differential.
GenevisibleiO88658. RN.

Interactioni

Subunit structurei

Interacts with KBP (By similarity). Interacts (via C-terminus end of the kinesin-motor domain) with CHP1; the interaction occurs in a calcium-dependent manner.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
Chp1P610234EBI-6143515,EBI-917838

Protein-protein interaction databases

IntActiO88658. 5 interactions.
MINTiMINT-261169.
STRINGi10116.ENSRNOP00000049243.

Structurei

3D structure databases

ProteinModelPortaliO88658.
SMRiO88658. Positions 4-353, 531-647.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini5 – 354350Kinesin motorPROSITE-ProRule annotationAdd
BLAST
Domaini556 – 61257FHAPROSITE-ProRule annotationAdd
BLAST
Domaini1701 – 179999PHPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni270 – 35081Interaction with KBPBy similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili470 – 51243Sequence analysisAdd
BLAST
Coiled coili672 – 73160Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi294 – 3007Poly-Lys
Compositional biasi1459 – 14624Poly-Arg
Compositional biasi1521 – 1659139Ser-richAdd
BLAST

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation
Contains 1 FHA domain.PROSITE-ProRule annotation
Contains 1 kinesin motor domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0245. Eukaryota.
COG5059. LUCA.
GeneTreeiENSGT00840000129680.
HOGENOMiHOG000165968.
HOVERGENiHBG052251.
InParanoidiO88658.
KOiK10392.
OMAiGQSMSKY.
OrthoDBiEOG091G009V.
PhylomeDBiO88658.
TreeFamiTF105221.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR000253. FHA_dom.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR022140. Kinesin-like_KIF1-typ.
IPR032405. Kinesin_assoc.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 3 hits.
PfamiPF12473. DUF3694. 1 hit.
PF00498. FHA. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF16183. Kinesin_assoc. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O88658-1) [UniParc]FASTAAdd to basket
Also known as: KIF1Bbeta2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGASVKVAV RVRPFNSRET SKESKCIIQM QGNSTSIINP KNPKEAPKSF
60 70 80 90 100
SFDYSYWSHT SPEDPCFASQ SRVYNDIGKE MLLHAFEGYN VCIFAYGQTG
110 120 130 140 150
AGKSYTMMGK QEESQAGIIP QLCEELFEKI NDNCNEDMSY SVEVSYMEIY
160 170 180 190 200
CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTSYT DIADLMDAGN
210 220 230 240 250
KARTVAATNM NETSSRSHAV FTIVFTQKKQ DPETNLSTEK VSKISLVDLA
260 270 280 290 300
GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEVDN CTSKSKKKKK
310 320 330 340 350
TDFIPYRDSV LTWLLRENLG GNSRTAMVAA LSPADINYDE TLSTLRYADR
360 370 380 390 400
AKQIKCNAVI NEDPNAKLVR ELKEEVTRLK DLLRAQGLGD IIDIDPLMDD
410 420 430 440 450
YSGSGGKYLK DFQNNKHRYL LASENQRPGN FSTASMGSLT SSPSSCSLNS
460 470 480 490 500
QAGLTSVTSI QERIMSTPGG EEAIERLKES EKIIAELNET WEEKLRKTEA
510 520 530 540 550
IRMEREALLA EMGVAIREDG GTLGVFSPKK TPHLVNLNED PLMSECLLYY
560 570 580 590 600
IKDGITRVGQ ADAERRQDIV LSGAHIKEEH CIFRSERNNT GEVIVTLEPC
610 620 630 640 650
ERSETYVNGK RVAHPVQLRS GNRIIMGKNH VFRFNHPEQA RAEREKTPSA
660 670 680 690 700
ETPSEPVDWT FAQRELLEKQ GIDMKQEMEK RLQEMEILYK REKEEADLLL
710 720 730 740 750
EQQRLDYESK LQALQKQVET RSLAAETTEE EEEEEEVPWT QHEFELAQWA
760 770 780 790 800
FRKWKSHQFT SLRDLLWGNA VYLKEANAIS VELKKKVQFQ FVLLTDTLYS
810 820 830 840 850
PVPPELLPTE MGKTHEDRPF PRTVVAVEVQ DLKNGATHYW SLDKLKQRLD
860 870 880 890 900
LMREMYDRAG EVGSNAQDDS ETTMTGSDPF YDRFHWFKLV GSSPIFHGCV
910 920 930 940 950
NERLADRTPS PTFSTADSDI TELADEQQDA MEDFDDEAFV DDTGSDAGTE
960 970 980 990 1000
EGSELFSDGH DPFYDRSPWF ILVGRAFVYL SNLLYPVPLI HRVAIVSEKG
1010 1020 1030 1040 1050
EVRGFLRVAV QAIAADEEAP DYGSGIRQSG TAKISFDNEY FNQSDFPSAA
1060 1070 1080 1090 1100
MTRSGLSLEE LRIVEGQGQS SEVISPPEEV NRMNDLDLKS GTLLDGKMVM
1110 1120 1130 1140 1150
EGFSEEIGNH LKLGSAFTFR VTVLQASGIL PEYADIFCQF NFLHRHDEAF
1160 1170 1180 1190 1200
STEPLKNNGR GSPLGFYHVQ NIAVEVTESF VDYIKTKPIV FEVFGHYQQH
1210 1220 1230 1240 1250
PLHLQGQELN SPPQPSRRFF PPPMPLSRPV PATKLNTMNK TSLGQSMSKY
1260 1270 1280 1290 1300
DLLVWFEISE LEPTGEYIPA VVDHTAGLPC QGTFLLHQGI QRRITVTIIH
1310 1320 1330 1340 1350
EKGSELHWKD VRELVVGRIR NKPEVDEAAV DAILSLNIIS AKSLKSSHSS
1360 1370 1380 1390 1400
SRTFYRFEAV WDSSLHNSLL LNRVTPYGEK IYMTLSAYLE LDHCIQPAVI
1410 1420 1430 1440 1450
TKDVCMVFYS RDAKISPPRS LRNLFGSGYS KSPDSNRVTG IYELSLCKMA
1460 1470 1480 1490 1500
DTGSPGMQRR RRKVLDTSVA YVRGEENLAG WRPRGDSLIL EHQWELEKLE
1510 1520 1530 1540 1550
LLHEVEKTRH FLLLRERLGD SIPKSMSDSL SPSLSSGTLS TSTSISSQIS
1560 1570 1580 1590 1600
TTTFESAITP SESSGYDSAD IESLVDREKE LATKCLQLLT HTFNREFSQV
1610 1620 1630 1640 1650
HGSISDCKLS DISPIGRDPS VSSFSSSTLT PSSTCPSLVD SRSSSMDQKT
1660 1670 1680 1690 1700
PEANSRASSP CQEFEQFQII PTVETPYLAR AGKNEFLNLV PDIEEVRAGS
1710 1720 1730 1740 1750
VVSKKGYLHF KEPLSSNWAK HFVVVRRPYV FIYNSDKDPV ERGIINLSTA
1760 1770 1780 1790 1800
QVEYSEDQQA MLKTPNTFAV CTKHRGVLLQ ALNDKDMNDW LYAFNPLLAG
1810
TIRSKLSRRC PSQPKY
Length:1,816
Mass (Da):204,170
Last modified:December 20, 2005 - v2
Checksum:i7A6EBD08EBAC2BF9
GO
Isoform 2 (identifier: O88658-2) [UniParc]FASTAAdd to basket
Also known as: KIF1Bbeta3

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLMDDYSGSGGKYLKDFQNNKHRYLLASENQRPGNFSTA → T
     889-971: Missing.

Show »
Length:1,687
Mass (Da):189,886
Checksum:iBAD8173AFEB564DA
GO
Isoform 3 (identifier: O88658-3) [UniParc]FASTAAdd to basket
Also known as: KIF1B

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     342-342: L → LST
     394-408: IDPLMDDYSGSGGKY → N
     707-1816: Missing.

Show »
Length:688
Mass (Da):77,301
Checksum:i9BB02E07C1BC4C2D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti121 – 1222QL → TC in AAC33292 (PubMed:9808286).Curated
Sequence conflicti143 – 1442EV → S in AAC33292 (PubMed:9808286).Curated
Sequence conflicti242 – 2421S → T in AAC33292 (PubMed:9808286).Curated
Sequence conflicti269 – 2691A → R in AAC33292 (PubMed:9808286).Curated
Sequence conflicti533 – 5342HL → QV in AAC33292 (PubMed:9808286).Curated
Sequence conflicti557 – 5582RV → KGF in AAC33292 (PubMed:9808286).Curated
Sequence conflicti575 – 5751H → HT in AAC33292 (PubMed:9808286).Curated
Sequence conflicti622 – 6276NRIIMG → TVSSWV in AAC33292 (PubMed:9808286).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei289 – 2946Missing in isoform 2 and isoform 3. 2 PublicationsVSP_016617
Alternative sequencei342 – 3421L → LST in isoform 3. 1 PublicationVSP_016618
Alternative sequencei394 – 43441IDPLM…NFSTA → T in isoform 2. 1 PublicationVSP_016619Add
BLAST
Alternative sequencei394 – 40815IDPLM…SGGKY → N in isoform 3. 1 PublicationVSP_016620Add
BLAST
Alternative sequencei707 – 18161110Missing in isoform 3. 1 PublicationVSP_016621Add
BLAST
Alternative sequencei889 – 97183Missing in isoform 2. 1 PublicationVSP_016622Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083331 mRNA. Translation: AAC33292.1.
AB070355 mRNA. Translation: BAB86917.1.
AB120429 mRNA. Translation: BAD51401.1.
RefSeqiNP_476548.1. NM_057200.2. [O88658-1]
UniGeneiRn.6526.

Genome annotation databases

EnsembliENSRNOT00000079919; ENSRNOP00000075228; ENSRNOG00000057626. [O88658-2]
ENSRNOT00000080888; ENSRNOP00000072431; ENSRNOG00000057626. [O88658-2]
ENSRNOT00000087739; ENSRNOP00000074322; ENSRNOG00000057626. [O88658-1]
ENSRNOT00000089099; ENSRNOP00000075522; ENSRNOG00000057626. [O88658-1]
GeneIDi117548.
KEGGirno:117548.
UCSCiRGD:621520. rat. [O88658-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083331 mRNA. Translation: AAC33292.1.
AB070355 mRNA. Translation: BAB86917.1.
AB120429 mRNA. Translation: BAD51401.1.
RefSeqiNP_476548.1. NM_057200.2. [O88658-1]
UniGeneiRn.6526.

3D structure databases

ProteinModelPortaliO88658.
SMRiO88658. Positions 4-353, 531-647.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiO88658. 5 interactions.
MINTiMINT-261169.
STRINGi10116.ENSRNOP00000049243.

PTM databases

iPTMnetiO88658.
PhosphoSiteiO88658.

Proteomic databases

PaxDbiO88658.
PRIDEiO88658.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000079919; ENSRNOP00000075228; ENSRNOG00000057626. [O88658-2]
ENSRNOT00000080888; ENSRNOP00000072431; ENSRNOG00000057626. [O88658-2]
ENSRNOT00000087739; ENSRNOP00000074322; ENSRNOG00000057626. [O88658-1]
ENSRNOT00000089099; ENSRNOP00000075522; ENSRNOG00000057626. [O88658-1]
GeneIDi117548.
KEGGirno:117548.
UCSCiRGD:621520. rat. [O88658-1]

Organism-specific databases

CTDi23095.
RGDi621520. Kif1b.

Phylogenomic databases

eggNOGiKOG0245. Eukaryota.
COG5059. LUCA.
GeneTreeiENSGT00840000129680.
HOGENOMiHOG000165968.
HOVERGENiHBG052251.
InParanoidiO88658.
KOiK10392.
OMAiGQSMSKY.
OrthoDBiEOG091G009V.
PhylomeDBiO88658.
TreeFamiTF105221.

Miscellaneous databases

PROiO88658.

Gene expression databases

ExpressionAtlasiO88658. differential.
GenevisibleiO88658. RN.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR000253. FHA_dom.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR022140. Kinesin-like_KIF1-typ.
IPR032405. Kinesin_assoc.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 3 hits.
PfamiPF12473. DUF3694. 1 hit.
PF00498. FHA. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF16183. Kinesin_assoc. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKIF1B_RAT
AccessioniPrimary (citable) accession number: O88658
Secondary accession number(s): Q65Z71, Q8R524
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: December 20, 2005
Last modified: September 7, 2016
This is version 142 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.