Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O88576 (S6A18_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 100. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sodium-dependent neutral amino acid transporter B(0)AT3
Alternative name(s):
Sodium- and chloride-dependent transporter XTRP2
Solute carrier family 6 member 18
System B(0) neutral amino acid transporter AT3
Gene names
Name:Slc6a18
Synonyms:Xt2, Xtrp2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length615 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Functions as a sodium and chloride-dependent neutral amino acid transporter. Ref.4

Subunit structure

Associates with TMEM27. TMEM27 association is required for functional expression in kidney.

Subcellular location

Membrane; Multi-pass membrane protein Probable.

Tissue specificity

Expressed predominantly in kidney. Ref.1

Disruption phenotype

Animals lacking this protein exhibit no gross abnormalities and grow to adulthood, although they do exhibit hypertension. The elevated blood pressure appears to be attributable to a decreased level of renal glycine. High-affinity renal reabsorption of glycine is eliminated and intrarenal glycine concentration is reduced. Ref.3

Sequence similarities

Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A18 subfamily. [View classification]

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O88576-1)

Also known as: A12;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O88576-2)

Also known as: A11;

The sequence of this isoform differs from the canonical sequence as follows:
     445-454: Missing.
Isoform 3 (identifier: O88576-3)

Also known as: B11;

The sequence of this isoform differs from the canonical sequence as follows:
     377-444: SASGPGLAFI...PKGIPKEVMT → PTWKQISGARVLGEGCARLTSRVCEASVLP
Isoform 4 (identifier: O88576-4)

Also known as: A10;

The sequence of this isoform differs from the canonical sequence as follows:
     499-552: FCDDIEWMTG...PSYKAWNPQY → NIFPQERRSS...GGRLRIWKVV
     553-615: Missing.
Isoform 5 (identifier: O88576-5)

Also known as: B9;

The sequence of this isoform differs from the canonical sequence as follows:
     377-444: SASGPGLAFI...PKGIPKEVMT → PTWKQISGARVLGEGCARLTSRVCEASVLP
     499-552: FCDDIEWMTG...PSYKAWNPQY → NIFPQERRSS...GGRLRIWKVV
     553-615: Missing.
Isoform 6 (identifier: O88576-6)

Also known as: A8;

The sequence of this isoform differs from the canonical sequence as follows:
     377-422: SASGPGLAFI...GLSSMFGNME → VLLCGLCSSL...SYPKVYPRRS
     423-615: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 615615Sodium-dependent neutral amino acid transporter B(0)AT3
PRO_0000214807

Regions

Topological domain1 – 2626Cytoplasmic Potential
Transmembrane27 – 4721Helical; Name=1; Potential
Topological domain48 – 525Extracellular Potential
Transmembrane53 – 7321Helical; Name=2; Potential
Topological domain74 – 10532Cytoplasmic Potential
Transmembrane106 – 12621Helical; Name=3; Potential
Topological domain127 – 17751Extracellular Potential
Transmembrane178 – 19821Helical; Name=4; Potential
Topological domain199 – 2068Cytoplasmic Potential
Transmembrane207 – 22721Helical; Name=5; Potential
Topological domain228 – 25528Extracellular Potential
Transmembrane256 – 27621Helical; Name=6; Potential
Topological domain277 – 28812Cytoplasmic Potential
Transmembrane289 – 30921Helical; Name=7; Potential
Topological domain310 – 39788Extracellular Potential
Transmembrane398 – 41821Helical; Name=8; Potential
Topological domain419 – 44123Cytoplasmic Potential
Transmembrane442 – 46221Helical; Name=9; Potential
Topological domain463 – 47210Extracellular Potential
Transmembrane473 – 49321Helical; Name=10; Potential
Topological domain494 – 52027Cytoplasmic Potential
Transmembrane521 – 54121Helical; Name=11; Potential
Topological domain542 – 57029Extracellular Potential
Transmembrane571 – 59121Helical; Name=12; Potential
Topological domain592 – 61524Cytoplasmic Potential

Amino acid modifications

Glycosylation3531N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence377 – 44468SASGP…KEVMT → PTWKQISGARVLGEGCARLT SRVCEASVLP in isoform 3 and isoform 5.
VSP_050364
Alternative sequence377 – 42246SASGP…FGNME → VLLCGLCSSLGCCLPWVCPP CLGTWRVSLHHYWTWGSYPK VYPRRS in isoform 6.
VSP_050363
Alternative sequence423 – 615193Missing in isoform 6.
VSP_050697
Alternative sequence445 – 45410Missing in isoform 2.
VSP_050365
Alternative sequence499 – 55254FCDDI…WNPQY → NIFPQERRSSTQAGCRSPVC SCPSCPHCGSLELLWLSYCP STNRGGRLRIWKVV in isoform 4 and isoform 5.
VSP_050366
Alternative sequence553 – 61563Missing in isoform 4 and isoform 5.
VSP_050367

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (A12) [UniParc].

Last modified November 1, 1998. Version 1.
Checksum: A7925C0397FC63F8

FASTA61569,229
        10         20         30         40         50         60 
MAQASGMDPL VDIEDERPKW DNKLQYLLSC IGFAVGLGNI WRFPYLCQTH GGGAFLIPYF 

        70         80         90        100        110        120 
IALVFEGIPL FYIELAIGQR LRRGSIGVWK TISPYLGGVG LGCFSVSFLV SLYYNTVLLW 

       130        140        150        160        170        180 
VLWFFLNSFQ HPLPWSTCPL DLNRTGFVQE CQSSGTVSYF WYRQTLNITS DISNTGTIQW 

       190        200        210        220        230        240 
KLFLCLVACW STVYLCVIRG IESTGKVIYF TALFPYLVLT IFLIRGLTLP GATEGLIYLF 

       250        260        270        280        290        300 
TPNMKTLQNP RVWLDAATQI FFSLSLAFGG HIAFASYNPP RNNCEKDAVI IALVNSMTSL 

       310        320        330        340        350        360 
YASIAIFSVM GFKASNDYGR CLDRNILSLI NEFDLPELSI SRDEYPSVLM YLNATQTARV 

       370        380        390        400        410        420 
AQLPLKTCHL EDFLDKSASG PGLAFIVFTE AVLHMPGASV WSVLFFGMLF TLGLSSMFGN 

       430        440        450        460        470        480 
MEGVITPLLD MGILPKGIPK EVMTGVICFA CFLSAICFTL QSGGYWLEIF DSFAASLNLI 

       490        500        510        520        530        540 
IFAFMEVVGV IHIYGMKRFC DDIEWMTGRR PGLYWQVTWR VVSPMLLFGI FLSYIVLLIQ 

       550        560        570        580        590        600 
TPPSYKAWNP QYEHFPSREE KFYPGWVQVT CVLLSFLPSL WVPGVALAQL LSQYKQRWKA 

       610 
THLESGLKLQ ESRGC 

« Hide

Isoform 2 (A11) [UniParc].

Checksum: E86342EE242445BF
Show »

FASTA60568,188
Isoform 3 (B11) [UniParc].

Checksum: 5F84F7C5CF1B14E3
Show »

FASTA57765,254
Isoform 4 (A10) [UniParc].

Checksum: 8DEE83992276B575
Show »

FASTA55261,513
Isoform 5 (B9) [UniParc].

Checksum: 3743C2342ECE0610
Show »

FASTA51457,538
Isoform 6 (A8) [UniParc].

Checksum: 6A794BDE016C00C3
Show »

FASTA42247,619

References

« Hide 'large scale' references
[1]"Cloning, gene structure, and genomic localization of an orphan transporter from mouse kidney with six alternatively-spliced isoforms."
Nash S.R., Giros B., Kingsmore S.F., Kim K.M., El-Mestikawy S., Dong Q., Fumagalli F., Seldin M.F., Caron M.G.
Recept. Channels 6:113-128(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6), TISSUE SPECIFICITY.
Tissue: Kidney.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Kidney.
[3]"Hypertension and impaired glycine handling in mice lacking the orphan transporter XT2."
Quan H., Athirakul K., Wetsel W.C., Torres G.E., Stevens R., Chen Y.T., Coffman T.M., Caron M.G.
Mol. Cell. Biol. 24:4166-4173(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: DISRUPTION PHENOTYPE.
[4]"Orphan transporter SLC6A18 is renal neutral amino acid transporter B0AT3."
Singer D., Camargo S.M., Huggel K., Romeo E., Danilczyk U., Kuba K., Chesnov S., Caron M.G., Penninger J.M., Verrey F.
J. Biol. Chem. 284:19953-19960(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PROBABLE FUNCTION, ASSOCIATION WITH TMEM27.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF075262 mRNA. Translation: AAC27757.1.
AF075263 mRNA. Translation: AAC27758.1.
AF075264 mRNA. Translation: AAC27759.1.
AF075265 mRNA. Translation: AAC27760.1.
AF075266 mRNA. Translation: AAC27761.1.
AF075267 mRNA. Translation: AAC27762.1.
BC010748 mRNA. Translation: AAH10748.1.
CCDSCCDS36727.1. [O88576-1]
CCDS49311.1. [O88576-3]
CCDS49312.1. [O88576-4]
RefSeqNP_001035782.1. NM_001040692.3. [O88576-1]
NP_001129559.1. NM_001136087.2. [O88576-3]
NP_001162115.1. NM_001168644.1. [O88576-4]
NP_001162116.1. NM_001168645.1. [O88576-5]
NP_001162117.1. NM_001168646.1. [O88576-2]
UniGeneMm.30370.

3D structure databases

ProteinModelPortalO88576.
SMRO88576. Positions 15-592.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-60421N.

PTM databases

PhosphoSiteO88576.

Proteomic databases

PaxDbO88576.
PRIDEO88576.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000022105; ENSMUSP00000022105; ENSMUSG00000021612. [O88576-1]
ENSMUST00000109679; ENSMUSP00000105301; ENSMUSG00000021612. [O88576-4]
ENSMUST00000109680; ENSMUSP00000105302; ENSMUSG00000021612. [O88576-3]
GeneID22598.
KEGGmmu:22598.
UCSCuc007rds.2. mouse. [O88576-1]
uc007rdt.2. mouse. [O88576-2]
uc007rdu.2. mouse. [O88576-3]
uc007rdv.2. mouse. [O88576-4]
uc007rdw.2. mouse. [O88576-5]

Organism-specific databases

CTD348932.
MGIMGI:1336892. Slc6a18.

Phylogenomic databases

eggNOGCOG0733.
GeneTreeENSGT00750000117287.
HOVERGENHBG071421.
InParanoidO88576.
KOK05048.
OMARNDCERD.
OrthoDBEOG793B71.
PhylomeDBO88576.
TreeFamTF343812.

Gene expression databases

BgeeO88576.
GenevestigatorO88576.

Family and domain databases

InterProIPR000175. Na/ntran_symport.
IPR002438. Na/ntran_symport_orphan.
[Graphical view]
PANTHERPTHR11616. PTHR11616. 1 hit.
PfamPF00209. SNF. 1 hit.
[Graphical view]
PRINTSPR00176. NANEUSMPORT.
PR01206. ORPHTRNSPORT.
PROSITEPS00610. NA_NEUROTRAN_SYMP_1. 1 hit.
PS00754. NA_NEUROTRAN_SYMP_2. 1 hit.
PS50267. NA_NEUROTRAN_SYMP_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio302949.
PROO88576.
SOURCESearch...

Entry information

Entry nameS6A18_MOUSE
AccessionPrimary (citable) accession number: O88576
Secondary accession number(s): O88577 expand/collapse secondary AC list , O88578, O88579, O88580, O88581, Q91XG6
Entry history
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: November 1, 1998
Last modified: July 9, 2014
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot