Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein Wiz

Gene

Wiz

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May link EHMT1 and EHMT2 histone methyltransferases to the CTBP corepressor machinery. May be involved in EHMT1-EHMT2 heterodimer formation and stabilization.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri308 – 33023C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri345 – 36723C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri454 – 47724C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri734 – 75623C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri802 – 82423C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri903 – 92523C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1076 – 109823C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1260 – 128223C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1430 – 145223C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1629 – 165527C2H2-type 10PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • SET domain binding Source: UniProtKB

GO - Biological processi

  • positive regulation of nuclear cell cycle DNA replication Source: MGI
  • protein heterotrimerization Source: UniProtKB
  • protein stabilization Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Protein Wiz
Alternative name(s):
Widely-interspaced zinc finger-containing protein
Gene namesi
Name:Wiz
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:1332638. Wiz.

Subcellular locationi

  • Nucleus 1 Publication

GO - Cellular componenti

  • extracellular exosome Source: MGI
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1631 – 16311C → A: Impairs interaction with EHMT1 and EHMT2. 1 Publication
Mutagenesisi1651 – 16511H → A: Impairs interaction with EHMT1 and EHMT2. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 16841684Protein WizPRO_0000286055Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki972 – 972Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1021 – 1021Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1029 – 10291PhosphoserineBy similarity
Modified residuei1031 – 10311PhosphothreonineBy similarity
Modified residuei1039 – 10391PhosphoserineCombined sources
Modified residuei1045 – 10451PhosphoserineCombined sources
Modified residuei1049 – 10491PhosphothreonineCombined sources
Modified residuei1050 – 10501PhosphoserineCombined sources
Modified residuei1112 – 11121PhosphoserineBy similarity
Cross-linki1141 – 1141Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1145 – 1145Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1160 – 11601PhosphoserineBy similarity
Modified residuei1167 – 11671PhosphoserineBy similarity
Modified residuei1179 – 11791PhosphoserineCombined sources
Modified residuei1184 – 11841PhosphoserineCombined sources
Modified residuei1195 – 11951N6,N6,N6-trimethyllysine; by EHMT2; alternateBy similarity
Modified residuei1195 – 11951N6,N6-dimethyllysine; by EHMT2; alternateBy similarity
Cross-linki1210 – 1210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1296 – 12961PhosphoserineBy similarity
Cross-linki1315 – 1315Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1342 – 13421PhosphoserineBy similarity
Modified residuei1347 – 13471PhosphoserineBy similarity
Cross-linki1376 – 1376Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1389 – 1389Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1403 – 1403Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1405 – 1405Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1415 – 1415Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1481 – 1481Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1510 – 1510Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1550 – 15501PhosphoserineBy similarity
Cross-linki1556 – 1556Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiO88286.
MaxQBiO88286.
PaxDbiO88286.
PRIDEiO88286.

PTM databases

iPTMnetiO88286.
PhosphoSiteiO88286.

Expressioni

Tissue specificityi

According to PubMed:9795207, isoform L and isoform S are brain-specific. According to PubMed:16702210, isoform S is ubiquitously expressed.2 Publications

Developmental stagei

Isoform L and isoform S are expressed in brain from E14 to adulthood, with highest levels in the perinatal period. At embryonic stages, isoform L seems to be excluded from cerebellum.1 Publication

Gene expression databases

BgeeiO88286.
CleanExiMM_WIZ.
ExpressionAtlasiO88286. baseline and differential.
GenevisibleiO88286. MM.

Interactioni

Subunit structurei

Part of a complex containing at least CDYL, REST, WIZ, SETB1, EHMT1 and EHMT2 (By similarity). Interacts with EHMT1, EHMT2, CTBP1 and CTBP2.By similarity1 Publication

GO - Molecular functioni

  • SET domain binding Source: UniProtKB

Protein-protein interaction databases

BioGridi204563. 28 interactions.
IntActiO88286. 26 interactions.
MINTiMINT-4105440.
STRINGi10090.ENSMUSP00000069443.

Structurei

3D structure databases

ProteinModelPortaliO88286.
SMRiO88286. Positions 301-372, 391-425, 445-484, 730-759, 787-827.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1063 – 10675Interaction with CTBP1 and CTBP2 1
Regioni1247 – 12515Interaction with CTBP1 and CTBP2 2

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi299 – 3046Poly-Glu
Compositional biasi601 – 6088Poly-Glu
Compositional biasi658 – 6636Poly-Gln
Compositional biasi786 – 7905Poly-Lys
Compositional biasi1174 – 11774Poly-Pro

Domaini

The C2H2-type zinc finger 10 mediates interaction with EHMT1 and EHMT2.

Sequence similaritiesi

Contains 10 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri308 – 33023C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri345 – 36723C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri454 – 47724C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri734 – 75623C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri802 – 82423C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri903 – 92523C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1076 – 109823C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1260 – 128223C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1430 – 145223C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1629 – 165527C2H2-type 10PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063587.
HOGENOMiHOG000154859.
HOVERGENiHBG108678.
InParanoidiO88286.
OMAiLTMPFPP.
PhylomeDBiO88286.
TreeFamiTF333705.

Family and domain databases

InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 11 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 7 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform L (identifier: O88286-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGLLAGGLA APDHPRGPAP REDIESGAEA AEGEGDIFPS SHYLPITKEG
60 70 80 90 100
PRDILDGRSG ISDGQPHPGL SEALPRATSA THRISSCYWD GDSLDFQPGS
110 120 130 140 150
PPPHLLGPFP ASLDVQGSWE HPMVQEAREG TPSEQRFKDS VIVRTMKPYA
160 170 180 190 200
KLKGSRKFLH HQGEVKFLEK YSPSHHKFDW LQDTDEQGPL KDTGLHLDLP
210 220 230 240 250
AQPPTVTSFR RVIVPVDNTP KTLDMEVMGT REDLEDFGQV AQPSEWGLHT
260 270 280 290 300
SASEVATQTW TVNSEASVER LQPLLSPVQT GPYLCELLQE VAGGVDSNEE
310 320 330 340 350
EEEEPAVFPC IECSIYFKHK EHLLEHMSQH RRAPGQEPPA DLAPLACSEC
360 370 380 390 400
GWAFTEPTAL EQHWQLHQAS REKIIEEIQK LKQFPGDEGR EARLQCSKCV
410 420 430 440 450
FGTNSSRAFM QHAKLHVRGS LPSRQATEPF RGGSPVLDVS TLVYPSYGDS
460 470 480 490 500
SGLNTCVHCG FTAPSKSLLR EHTRLVHAHH AHWEEVGEAF EDLTSQPCTS
510 520 530 540 550
QDAYTHSPDT ATVDYFSKSE PLLASVWQEN PSGYDPDLAF GPDYQQPGMR
560 570 580 590 600
NFPLLNSGQQ SLGKLAFPSP MASASYSIQR NRNKSTVHLQ RMEDKSHLWS
610 620 630 640 650
EEEEEEDEDV VLTSERDFTP ENGAFPPLAI PSLIPQPALE LKQTFQDALQ
660 670 680 690 700
AVDASETQQQ QLQGMVPIVL MAKLRPQVIA ATTRASPQLP PEEPELRSTH
710 720 730 740 750
PLDFLLLDAP LGGSLGLNTL LEGDPAMALK HEERKCPYCP DRFHYGIGLA
760 770 780 790 800
NHVRGHLNRV GVSYNVRHFI SAEEVKAIER RFSFQKKKKK VANFDPGTFS
810 820 830 840 850
LMRCDFCGAG FDTRAGLSSH ARAHLRDFGI TNWELTISPI NILQELLATS
860 870 880 890 900
AAELPPSPLG REPGGPPRSF LTSRRPRLPL TMPFPPTWAE DPGPIYGDAQ
910 920 930 940 950
SLTTCEVCGA CFETRKGLSS HARSHLRQLG VAESESSGAP IDLLYELVKQ
960 970 980 990 1000
KGLPDAPLGL TPSLTKKSNS PKEFLAGAAR PGLLTLAKPM DAPAVNKAIK
1010 1020 1030 1040 1050
SPPGFSAKGL THPSSSPLLK KAPLTLAGSP TPKNPEDKSP QLSLSPRPTS
1060 1070 1080 1090 1100
PKAQWPQSED EGPLNLTSGP EPTRDIRCEF CGEFFENRKG LSSHARSHLR
1110 1120 1130 1140 1150
QMGVTEWYVN GSPIDTLREI LKRRTQSRPG GHLHPPGPSP KALAKVLSTG
1160 1170 1180 1190 1200
GPGSSLEARS PSDLHISPLT KKLPPPPGSP LGHSPTASPP PTARKMFSGL
1210 1220 1230 1240 1250
ATPSLPKKLK PEHMRVEIKR EMLPGTLHGE PHPSEGPWGT PREDMAPLNL
1260 1270 1280 1290 1300
SARAEPVRDI RCEFCGEFFE NRKGLSSHAR SHLRQMGVTE WSVNGSPIDT
1310 1320 1330 1340 1350
LREILKKKSK LCLIKKEPPA GDLAPALTED GSPTAAPGAL HSPLPLSPLA
1360 1370 1380 1390 1400
SRPGKPGAGP TQVPRELSLS PITGSKPSAA SYLGPVATKR PLQEDRFLPA
1410 1420 1430 1440 1450
EVKAKTYIQT ELPFKAKTLH EKTSHSSTEA CCELCGLYFE NRKALASHAR
1460 1470 1480 1490 1500
AHLRQFGVTE WCVNGSPIET LSEWIKHRPQ KVGAYRSYIQ GGRPFTKKFR
1510 1520 1530 1540 1550
SAGHGRDSDK RPPLGLAPGG LSLVGRSAGG EPGLEAGRAA DSGERPLATS
1560 1570 1580 1590 1600
PPGTVKSEEH QRQNINKFER RQARPSDASA ARGGEEVNDL QQKLEEVRQP
1610 1620 1630 1640 1650
PPRVRPVPSL VPRPPQTSLV KFVGNIYTLK CRFCEVEFQG PLSIQEEWVR
1660 1670 1680
HLQRHILEMN FSKADPPPEE PQAPQAQTAA VEAP
Length:1,684
Mass (Da):184,291
Last modified:May 1, 2007 - v2
Checksum:i67BA8AC25A97DDEB
GO
Isoform S (identifier: O88286-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-790: Missing.

Show »
Length:956
Mass (Da):103,003
Checksum:i4DDE4A816FC04D65
GO
Isoform 2 (identifier: O88286-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-759: Missing.
     760-789: VGVSYNVRHFISAEEVKAIERRFSFQKKKK → MAEVAFLMGSPILASAKPSPVPPPPPIGSA
     898-898: D → DGLCSEENTMVAMDLGSPLLPKKSLPVSGTLEQVASRLSSKVAAEVPHGSKQELPDLK

Note: No experimental confirmation available.
Show »
Length:982
Mass (Da):105,637
Checksum:i1304FDF9672338FC
GO
Isoform 3 (identifier: O88286-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     745-798: YGIGLANHVR...KKVANFDPGT → NGIVLRPPAA...AQILLLRHQL
     799-1684: Missing.

Note: No experimental confirmation available.
Show »
Length:798
Mass (Da):88,329
Checksum:iCD980D3BFAD521B6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti492 – 4921D → G in BAA32790 (PubMed:9795207).Curated
Sequence conflicti868 – 8681R → G in BAA32790 (PubMed:9795207).Curated
Sequence conflicti868 – 8681R → G in BAA32791 (PubMed:9795207).Curated
Sequence conflicti1020 – 10201K → N in AAH53035 (PubMed:16141072).Curated
Sequence conflicti1052 – 10521K → R in BAA32790 (PubMed:9795207).Curated
Sequence conflicti1052 – 10521K → R in BAA32791 (PubMed:9795207).Curated
Sequence conflicti1055 – 10551W → C in BAA32790 (PubMed:9795207).Curated
Sequence conflicti1055 – 10551W → C in BAA32791 (PubMed:9795207).Curated
Sequence conflicti1252 – 12521Missing in BAA32790 (PubMed:9795207).Curated
Sequence conflicti1252 – 12521Missing in BAA32791 (PubMed:9795207).Curated

Polymorphismi

C57BL/6J and C57BR/cdJ mice specifically present an insertion of a type II early transposon in the opposite orientation into exon 6. This results in a strong reduction in the protein levels of isoform L.1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 759759Missing in isoform 2. 1 PublicationVSP_024953Add
BLAST
Alternative sequencei63 – 790728Missing in isoform S. 2 PublicationsVSP_024954Add
BLAST
Alternative sequencei745 – 79854YGIGL…FDPGT → NGIVLRPPAARNVNGSTEKA ARAVREESRRGKRRNVAKTV TLIKAQILLLRHQL in isoform 3. 1 PublicationVSP_024955Add
BLAST
Alternative sequencei760 – 78930VGVSY…QKKKK → MAEVAFLMGSPILASAKPSP VPPPPPIGSA in isoform 2. 1 PublicationVSP_024956Add
BLAST
Alternative sequencei799 – 1684886Missing in isoform 3. 1 PublicationVSP_024957Add
BLAST
Alternative sequencei898 – 8981D → DGLCSEENTMVAMDLGSPLL PKKSLPVSGTLEQVASRLSS KVAAEVPHGSKQELPDLK in isoform 2. 1 PublicationVSP_024958

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB012265 mRNA. Translation: BAA32790.1.
AB012266 mRNA. Translation: BAA32791.1.
AB255388 mRNA. Translation: BAE93139.1.
AK004274 mRNA. Translation: BAB23245.1.
AK133564 mRNA. Translation: BAE21728.1.
BC053035 mRNA. Translation: AAH53035.1.
CCDSiCCDS28617.2. [O88286-2]
PIRiT00247.
T00248.
RefSeqiNP_035847.2. NM_011717.4.
NP_997603.3. NM_212438.3. [O88286-2]
XP_006524131.1. XM_006524068.2. [O88286-2]
XP_006524132.1. XM_006524069.1. [O88286-4]
UniGeneiMm.274948.

Genome annotation databases

EnsembliENSMUST00000064694; ENSMUSP00000069443; ENSMUSG00000024050. [O88286-2]
GeneIDi22404.
KEGGimmu:22404.
UCSCiuc008bwn.2. mouse. [O88286-2]
uc008bwq.2. mouse. [O88286-3]
uc008bwt.2. mouse. [O88286-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB012265 mRNA. Translation: BAA32790.1.
AB012266 mRNA. Translation: BAA32791.1.
AB255388 mRNA. Translation: BAE93139.1.
AK004274 mRNA. Translation: BAB23245.1.
AK133564 mRNA. Translation: BAE21728.1.
BC053035 mRNA. Translation: AAH53035.1.
CCDSiCCDS28617.2. [O88286-2]
PIRiT00247.
T00248.
RefSeqiNP_035847.2. NM_011717.4.
NP_997603.3. NM_212438.3. [O88286-2]
XP_006524131.1. XM_006524068.2. [O88286-2]
XP_006524132.1. XM_006524069.1. [O88286-4]
UniGeneiMm.274948.

3D structure databases

ProteinModelPortaliO88286.
SMRiO88286. Positions 301-372, 391-425, 445-484, 730-759, 787-827.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204563. 28 interactions.
IntActiO88286. 26 interactions.
MINTiMINT-4105440.
STRINGi10090.ENSMUSP00000069443.

PTM databases

iPTMnetiO88286.
PhosphoSiteiO88286.

Proteomic databases

EPDiO88286.
MaxQBiO88286.
PaxDbiO88286.
PRIDEiO88286.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000064694; ENSMUSP00000069443; ENSMUSG00000024050. [O88286-2]
GeneIDi22404.
KEGGimmu:22404.
UCSCiuc008bwn.2. mouse. [O88286-2]
uc008bwq.2. mouse. [O88286-3]
uc008bwt.2. mouse. [O88286-4]

Organism-specific databases

CTDi58525.
MGIiMGI:1332638. Wiz.

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063587.
HOGENOMiHOG000154859.
HOVERGENiHBG108678.
InParanoidiO88286.
OMAiLTMPFPP.
PhylomeDBiO88286.
TreeFamiTF333705.

Miscellaneous databases

PROiO88286.
SOURCEiSearch...

Gene expression databases

BgeeiO88286.
CleanExiMM_WIZ.
ExpressionAtlasiO88286. baseline and differential.
GenevisibleiO88286. MM.

Family and domain databases

InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 11 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 7 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and distinct developmental expression pattern of spliced forms of a novel zinc finger gene wiz in the mouse cerebellum."
    Matsumoto K., Ishii N., Yoshida S., Shiosaka S., Wanaka A., Tohyama M.
    Brain Res. Mol. Brain Res. 61:179-189(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS L AND S), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Brain.
  2. "Zinc finger protein Wiz links G9a/GLP histone methyltransferases to the co-repressor molecule CtBP."
    Ueda J., Tachibana M., Ikura T., Shinkai Y.
    J. Biol. Chem. 281:20120-20128(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM S), FUNCTION, TISSUE SPECIFICITY, IDENTIFICATION BY MASS SPECTROMETRY, INTERACTION WITH EHMT1; EHMT2; CTBP1 AND CTBP2, SUBCELLULAR LOCATION, MUTAGENESIS OF CYS-1631 AND HIS-1651.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1525-1684 (ISOFORM L).
    Strain: C57BL/6J.
    Tissue: Embryo and Pituitary.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Brain.
  5. "Insertional polymorphisms of ETn retrotransposons include a disruption of the wiz gene in C57BL/6 mice."
    Baust C., Baillie G.J., Mager D.L.
    Mamm. Genome 13:423-428(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: POLYMORPHISM.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1045 AND THR-1049, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1039; SER-1045; THR-1049; SER-1050; SER-1179 AND SER-1184, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiWIZ_MOUSE
AccessioniPrimary (citable) accession number: O88286
Secondary accession number(s): O88287
, Q1XG03, Q3UZX7, Q7TSJ4, Q9CT89
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 1, 2007
Last modified: June 8, 2016
This is version 130 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.