Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein Wiz

Gene

Wiz

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May link EHMT1 and EHMT2 histone methyltransferases to the CTBP corepressor machinery. May be involved in EHMT1-EHMT2 heterodimer formation and stabilization.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri308 – 330C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri345 – 367C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri454 – 477C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri734 – 756C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri802 – 824C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri903 – 925C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1076 – 1098C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1260 – 1282C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1430 – 1452C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1629 – 1655C2H2-type 10PROSITE-ProRule annotationAdd BLAST27

GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • nucleic acid binding Source: InterPro
  • SET domain binding Source: UniProtKB

GO - Biological processi

  • positive regulation of nuclear cell cycle DNA replication Source: MGI
  • protein heterotrimerization Source: UniProtKB
  • protein stabilization Source: UniProtKB

Keywordsi

LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Protein Wiz
Alternative name(s):
Widely-interspaced zinc finger-containing protein
Gene namesi
Name:Wiz
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:1332638. Wiz.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1631C → A: Impairs interaction with EHMT1 and EHMT2. 1 Publication1
Mutagenesisi1651H → A: Impairs interaction with EHMT1 and EHMT2. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002860551 – 1684Protein WizAdd BLAST1684

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki916Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki972Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki988Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1000Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1021Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1029PhosphoserineBy similarity1
Modified residuei1031PhosphothreonineBy similarity1
Cross-linki1033Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1038Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1039PhosphoserineCombined sources1
Modified residuei1045PhosphoserineCombined sources1
Modified residuei1049PhosphothreonineCombined sources1
Modified residuei1050PhosphoserineCombined sources1
Modified residuei1058PhosphoserineBy similarity1
Cross-linki1089Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1112PhosphoserineBy similarity1
Modified residuei1139PhosphoserineBy similarity1
Cross-linki1141Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1145Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1155PhosphoserineBy similarity1
Modified residuei1160PhosphoserineBy similarity1
Modified residuei1167PhosphoserineBy similarity1
Cross-linki1171Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1172Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1179PhosphoserineCombined sources1
Modified residuei1184PhosphoserineCombined sources1
Modified residuei1195N6,N6,N6-trimethyllysine; by EHMT2; alternateBy similarity1
Modified residuei1195N6,N6-dimethyllysine; by EHMT2; alternateBy similarity1
Cross-linki1210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1273Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1296PhosphoserineBy similarity1
Cross-linki1315Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1342PhosphoserineBy similarity1
Modified residuei1347PhosphoserineBy similarity1
Cross-linki1376Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1389Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1403Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1405Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1415Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1481Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1497Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1510Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1550PhosphoserineBy similarity1
Cross-linki1556Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)By similarity
Cross-linki1556Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1567Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1593Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1663Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiO88286.
MaxQBiO88286.
PaxDbiO88286.
PeptideAtlasiO88286.
PRIDEiO88286.

PTM databases

iPTMnetiO88286.
PhosphoSitePlusiO88286.

Expressioni

Tissue specificityi

According to PubMed:9795207, isoform L and isoform S are brain-specific. According to PubMed:16702210, isoform S is ubiquitously expressed.2 Publications

Developmental stagei

Isoform L and isoform S are expressed in brain from E14 to adulthood, with highest levels in the perinatal period. At embryonic stages, isoform L seems to be excluded from cerebellum.1 Publication

Gene expression databases

BgeeiENSMUSG00000024050.
CleanExiMM_WIZ.
ExpressionAtlasiO88286. baseline and differential.
GenevisibleiO88286. MM.

Interactioni

Subunit structurei

Part of a complex containing at least CDYL, REST, WIZ, SETB1, EHMT1 and EHMT2 (By similarity). Interacts with EHMT1, EHMT2, CTBP1 and CTBP2.By similarity1 Publication

GO - Molecular functioni

  • SET domain binding Source: UniProtKB

Protein-protein interaction databases

BioGridi204563. 28 interactors.
IntActiO88286. 26 interactors.
MINTiMINT-4105440.
STRINGi10090.ENSMUSP00000069443.

Structurei

3D structure databases

ProteinModelPortaliO88286.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1063 – 1067Interaction with CTBP1 and CTBP2 11 Publication5
Regioni1247 – 1251Interaction with CTBP1 and CTBP2 21 Publication5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi299 – 304Poly-Glu6
Compositional biasi601 – 608Poly-Glu8
Compositional biasi658 – 663Poly-Gln6
Compositional biasi786 – 790Poly-Lys5
Compositional biasi1174 – 1177Poly-Pro4

Domaini

The C2H2-type zinc finger 10 mediates interaction with EHMT1 and EHMT2.

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri308 – 330C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri345 – 367C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri454 – 477C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri734 – 756C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri802 – 824C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri903 – 925C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1076 – 1098C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1260 – 1282C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1430 – 1452C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1629 – 1655C2H2-type 10PROSITE-ProRule annotationAdd BLAST27

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063587.
HOGENOMiHOG000154859.
HOVERGENiHBG108678.
InParanoidiO88286.
OMAiHFGLECS.
PhylomeDBiO88286.
TreeFamiTF333705.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiView protein in InterPro
IPR036236. Znf_C2H2_sf.
IPR013087. Znf_C2H2_type.
IPR013083. Znf_RING/FYVE/PHD.
SMARTiView protein in SMART
SM00355. ZnF_C2H2. 11 hits.
SUPFAMiSSF57667. SSF57667. 5 hits.
PROSITEiView protein in PROSITE
PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 7 hits.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform L (identifier: O88286-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGLLAGGLA APDHPRGPAP REDIESGAEA AEGEGDIFPS SHYLPITKEG
60 70 80 90 100
PRDILDGRSG ISDGQPHPGL SEALPRATSA THRISSCYWD GDSLDFQPGS
110 120 130 140 150
PPPHLLGPFP ASLDVQGSWE HPMVQEAREG TPSEQRFKDS VIVRTMKPYA
160 170 180 190 200
KLKGSRKFLH HQGEVKFLEK YSPSHHKFDW LQDTDEQGPL KDTGLHLDLP
210 220 230 240 250
AQPPTVTSFR RVIVPVDNTP KTLDMEVMGT REDLEDFGQV AQPSEWGLHT
260 270 280 290 300
SASEVATQTW TVNSEASVER LQPLLSPVQT GPYLCELLQE VAGGVDSNEE
310 320 330 340 350
EEEEPAVFPC IECSIYFKHK EHLLEHMSQH RRAPGQEPPA DLAPLACSEC
360 370 380 390 400
GWAFTEPTAL EQHWQLHQAS REKIIEEIQK LKQFPGDEGR EARLQCSKCV
410 420 430 440 450
FGTNSSRAFM QHAKLHVRGS LPSRQATEPF RGGSPVLDVS TLVYPSYGDS
460 470 480 490 500
SGLNTCVHCG FTAPSKSLLR EHTRLVHAHH AHWEEVGEAF EDLTSQPCTS
510 520 530 540 550
QDAYTHSPDT ATVDYFSKSE PLLASVWQEN PSGYDPDLAF GPDYQQPGMR
560 570 580 590 600
NFPLLNSGQQ SLGKLAFPSP MASASYSIQR NRNKSTVHLQ RMEDKSHLWS
610 620 630 640 650
EEEEEEDEDV VLTSERDFTP ENGAFPPLAI PSLIPQPALE LKQTFQDALQ
660 670 680 690 700
AVDASETQQQ QLQGMVPIVL MAKLRPQVIA ATTRASPQLP PEEPELRSTH
710 720 730 740 750
PLDFLLLDAP LGGSLGLNTL LEGDPAMALK HEERKCPYCP DRFHYGIGLA
760 770 780 790 800
NHVRGHLNRV GVSYNVRHFI SAEEVKAIER RFSFQKKKKK VANFDPGTFS
810 820 830 840 850
LMRCDFCGAG FDTRAGLSSH ARAHLRDFGI TNWELTISPI NILQELLATS
860 870 880 890 900
AAELPPSPLG REPGGPPRSF LTSRRPRLPL TMPFPPTWAE DPGPIYGDAQ
910 920 930 940 950
SLTTCEVCGA CFETRKGLSS HARSHLRQLG VAESESSGAP IDLLYELVKQ
960 970 980 990 1000
KGLPDAPLGL TPSLTKKSNS PKEFLAGAAR PGLLTLAKPM DAPAVNKAIK
1010 1020 1030 1040 1050
SPPGFSAKGL THPSSSPLLK KAPLTLAGSP TPKNPEDKSP QLSLSPRPTS
1060 1070 1080 1090 1100
PKAQWPQSED EGPLNLTSGP EPTRDIRCEF CGEFFENRKG LSSHARSHLR
1110 1120 1130 1140 1150
QMGVTEWYVN GSPIDTLREI LKRRTQSRPG GHLHPPGPSP KALAKVLSTG
1160 1170 1180 1190 1200
GPGSSLEARS PSDLHISPLT KKLPPPPGSP LGHSPTASPP PTARKMFSGL
1210 1220 1230 1240 1250
ATPSLPKKLK PEHMRVEIKR EMLPGTLHGE PHPSEGPWGT PREDMAPLNL
1260 1270 1280 1290 1300
SARAEPVRDI RCEFCGEFFE NRKGLSSHAR SHLRQMGVTE WSVNGSPIDT
1310 1320 1330 1340 1350
LREILKKKSK LCLIKKEPPA GDLAPALTED GSPTAAPGAL HSPLPLSPLA
1360 1370 1380 1390 1400
SRPGKPGAGP TQVPRELSLS PITGSKPSAA SYLGPVATKR PLQEDRFLPA
1410 1420 1430 1440 1450
EVKAKTYIQT ELPFKAKTLH EKTSHSSTEA CCELCGLYFE NRKALASHAR
1460 1470 1480 1490 1500
AHLRQFGVTE WCVNGSPIET LSEWIKHRPQ KVGAYRSYIQ GGRPFTKKFR
1510 1520 1530 1540 1550
SAGHGRDSDK RPPLGLAPGG LSLVGRSAGG EPGLEAGRAA DSGERPLATS
1560 1570 1580 1590 1600
PPGTVKSEEH QRQNINKFER RQARPSDASA ARGGEEVNDL QQKLEEVRQP
1610 1620 1630 1640 1650
PPRVRPVPSL VPRPPQTSLV KFVGNIYTLK CRFCEVEFQG PLSIQEEWVR
1660 1670 1680
HLQRHILEMN FSKADPPPEE PQAPQAQTAA VEAP
Length:1,684
Mass (Da):184,291
Last modified:May 1, 2007 - v2
Checksum:i67BA8AC25A97DDEB
GO
Isoform S (identifier: O88286-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-790: Missing.

Show »
Length:956
Mass (Da):103,003
Checksum:i4DDE4A816FC04D65
GO
Isoform 2 (identifier: O88286-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-759: Missing.
     760-789: VGVSYNVRHFISAEEVKAIERRFSFQKKKK → MAEVAFLMGSPILASAKPSPVPPPPPIGSA
     898-898: D → DGLCSEENTMVAMDLGSPLLPKKSLPVSGTLEQVASRLSSKVAAEVPHGSKQELPDLK

Note: No experimental confirmation available.
Show »
Length:982
Mass (Da):105,637
Checksum:i1304FDF9672338FC
GO
Isoform 3 (identifier: O88286-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     745-798: YGIGLANHVR...KKVANFDPGT → NGIVLRPPAA...AQILLLRHQL
     799-1684: Missing.

Note: No experimental confirmation available.
Show »
Length:798
Mass (Da):88,329
Checksum:iCD980D3BFAD521B6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti492D → G in BAA32790 (PubMed:9795207).Curated1
Sequence conflicti868R → G in BAA32790 (PubMed:9795207).Curated1
Sequence conflicti868R → G in BAA32791 (PubMed:9795207).Curated1
Sequence conflicti1020K → N in AAH53035 (PubMed:16141072).Curated1
Sequence conflicti1052K → R in BAA32790 (PubMed:9795207).Curated1
Sequence conflicti1052K → R in BAA32791 (PubMed:9795207).Curated1
Sequence conflicti1055W → C in BAA32790 (PubMed:9795207).Curated1
Sequence conflicti1055W → C in BAA32791 (PubMed:9795207).Curated1
Sequence conflicti1252Missing in BAA32790 (PubMed:9795207).Curated1
Sequence conflicti1252Missing in BAA32791 (PubMed:9795207).Curated1

Polymorphismi

C57BL/6J and C57BR/cdJ mice specifically present an insertion of a type II early transposon in the opposite orientation into exon 6. This results in a strong reduction in the protein levels of isoform L.1 Publication

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0249531 – 759Missing in isoform 2. 1 PublicationAdd BLAST759
Alternative sequenceiVSP_02495463 – 790Missing in isoform S. 2 PublicationsAdd BLAST728
Alternative sequenceiVSP_024955745 – 798YGIGL…FDPGT → NGIVLRPPAARNVNGSTEKA ARAVREESRRGKRRNVAKTV TLIKAQILLLRHQL in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_024956760 – 789VGVSY…QKKKK → MAEVAFLMGSPILASAKPSP VPPPPPIGSA in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_024957799 – 1684Missing in isoform 3. 1 PublicationAdd BLAST886
Alternative sequenceiVSP_024958898D → DGLCSEENTMVAMDLGSPLL PKKSLPVSGTLEQVASRLSS KVAAEVPHGSKQELPDLK in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB012265 mRNA. Translation: BAA32790.1.
AB012266 mRNA. Translation: BAA32791.1.
AB255388 mRNA. Translation: BAE93139.1.
AK004274 mRNA. Translation: BAB23245.1.
AK133564 mRNA. Translation: BAE21728.1.
BC053035 mRNA. Translation: AAH53035.1.
CCDSiCCDS28617.2. [O88286-2]
PIRiT00247.
T00248.
RefSeqiNP_035847.2. NM_011717.4.
NP_997603.3. NM_212438.3. [O88286-2]
XP_017172890.1. XM_017317401.1. [O88286-2]
UniGeneiMm.274948.

Genome annotation databases

EnsembliENSMUST00000064694; ENSMUSP00000069443; ENSMUSG00000024050. [O88286-2]
GeneIDi22404.
KEGGimmu:22404.
UCSCiuc008bwn.2. mouse. [O88286-2]
uc008bwq.2. mouse. [O88286-3]
uc008bwt.2. mouse. [O88286-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiWIZ_MOUSE
AccessioniPrimary (citable) accession number: O88286
Secondary accession number(s): O88287
, Q1XG03, Q3UZX7, Q7TSJ4, Q9CT89
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 1, 2007
Last modified: October 25, 2017
This is version 141 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families