Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine carboxypeptidase-like 12

Gene

SCPL12

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Probable carboxypeptidase.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei176 – 1761By similarity
Active sitei360 – 3601By similarity
Active sitei413 – 4131By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Carboxypeptidase, Hydrolase, Protease

Enzyme and pathway databases

BioCyciARA:AT2G22920-MONOMER.
ARA:GQT-1439-MONOMER.
ARA:GQT-1440-MONOMER.

Protein family/group databases

ESTHERiarath-SCP12. Carboxypeptidase_S10.
MEROPSiS10.A09.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine carboxypeptidase-like 12 (EC:3.4.16.-)
Gene namesi
Name:SCPL12
Ordered Locus Names:At2g22920
ORF Names:T20K9.13
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 2

Organism-specific databases

TAIRiAT2G22920.

Subcellular locationi

GO - Cellular componenti

  • extracellular region Source: UniProtKB-SubCell
  • plant-type cell wall Source: TAIR
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Sequence analysisAdd
BLAST
Chaini22 – 435414Serine carboxypeptidase-like 12PRO_0000274626Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi80 ↔ 323By similarity
Glycosylationi101 – 1011N-linked (GlcNAc...)Sequence analysis
Disulfide bondi244 ↔ 258By similarity
Disulfide bondi282 ↔ 289By similarity
Glycosylationi313 – 3131N-linked (GlcNAc...)Sequence analysis
Glycosylationi336 – 3361N-linked (GlcNAc...)Sequence analysis
Glycosylationi344 – 3441N-linked (GlcNAc...)Sequence analysis
Glycosylationi376 – 3761N-linked (GlcNAc...)Sequence analysis
Glycosylationi420 – 4201N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO81009.
PRIDEiO81009.

Expressioni

Tissue specificityi

Expressed in roots.1 Publication

Gene expression databases

ExpressionAtlasiO81009. baseline and differential.
GenevisibleiO81009. AT.

Interactioni

Protein-protein interaction databases

STRINGi3702.AT2G22920.2.

Structurei

3D structure databases

ProteinModelPortaliO81009.
SMRiO81009. Positions 25-431.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase S10 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG1282. Eukaryota.
COG2939. LUCA.
HOGENOMiHOG000198297.
InParanoidiO81009.
KOiK16296.
OMAiQENAISP.
OrthoDBiEOG093600MP.
PhylomeDBiO81009.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR001563. Peptidase_S10.
[Graphical view]
PANTHERiPTHR11802. PTHR11802. 1 hit.
PfamiPF00450. Peptidase_S10. 1 hit.
[Graphical view]
PRINTSiPR00724. CRBOXYPTASEC.
SUPFAMiSSF53474. SSF53474. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O81009-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKSTPKLLLL LLFIINHHVD SGSIVKFLPG FEGPLPFELE TGYIGIGEEE
60 70 80 90 100
DVQLFYYFIK SERNPKEDPL LLWLSGGPGC SSITGLLFEN GPLALKSKVY
110 120 130 140 150
NGSVPSLVST TYSWTKTANI IFLDQPIGAG FSYSRIPLID TPSDTGEVKN
160 170 180 190 200
IHEFLQKWLS KHPQFSSNPF YASGDSYSGM IVPALVQEIS KGNYICCKPP
210 220 230 240 250
INLQGYILGN PITYFEVDQN YRIPFSHGMA LISDELYESI RRDCKGNYFN
260 270 280 290 300
VDPRNTKCLK LVEEYHKCTD ELNEFNILSP DCDTTSPDCF LYPYYLLGYW
310 320 330 340 350
INDESVRDAL HVNKSSIGKW ERCTYQNRIP YNKDINNSIP YHMNNSISGY
360 370 380 390 400
RSLIYSGDHD LVVPFLATQA WIKSLNYSII HEWRPWMIKD QIAGYTRTYS
410 420 430
NKMTFATVKG SGHTAEYKPN ETFIMFQRWI SGHDL
Length:435
Mass (Da):49,705
Last modified:November 1, 1998 - v1
Checksum:iC6F50A686AD2D617
GO
Isoform 2 (identifier: O81009-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-435: TRTYSNKMTFATVKGSGHTAEYKPNETFIMFQRWISGHDL → IIYFCVIHENLFQ

Note: Derived from EST data. May be due to a competing donor splice site. No experimental confirmation available.
Show »
Length:408
Mass (Da):46,691
Checksum:iBBA69D18EE187E38
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei396 – 43540TRTYS…SGHDL → IIYFCVIHENLFQ in isoform 2. CuratedVSP_027465Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC004786 Genomic DNA. Translation: AAC32439.1.
CP002685 Genomic DNA. Translation: AEC07373.1.
CP002685 Genomic DNA. Translation: AEC07374.1.
PIRiE84618.
RefSeqiNP_179876.1. NM_127857.4. [O81009-1]
NP_850033.1. NM_179702.1. [O81009-2]
UniGeneiAt.39371.

Genome annotation databases

EnsemblPlantsiAT2G22920.2; AT2G22920.2; AT2G22920. [O81009-1]
GeneIDi816823.
KEGGiath:AT2G22920.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC004786 Genomic DNA. Translation: AAC32439.1.
CP002685 Genomic DNA. Translation: AEC07373.1.
CP002685 Genomic DNA. Translation: AEC07374.1.
PIRiE84618.
RefSeqiNP_179876.1. NM_127857.4. [O81009-1]
NP_850033.1. NM_179702.1. [O81009-2]
UniGeneiAt.39371.

3D structure databases

ProteinModelPortaliO81009.
SMRiO81009. Positions 25-431.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT2G22920.2.

Protein family/group databases

ESTHERiarath-SCP12. Carboxypeptidase_S10.
MEROPSiS10.A09.

Proteomic databases

PaxDbiO81009.
PRIDEiO81009.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT2G22920.2; AT2G22920.2; AT2G22920. [O81009-1]
GeneIDi816823.
KEGGiath:AT2G22920.

Organism-specific databases

TAIRiAT2G22920.

Phylogenomic databases

eggNOGiKOG1282. Eukaryota.
COG2939. LUCA.
HOGENOMiHOG000198297.
InParanoidiO81009.
KOiK16296.
OMAiQENAISP.
OrthoDBiEOG093600MP.
PhylomeDBiO81009.

Enzyme and pathway databases

BioCyciARA:AT2G22920-MONOMER.
ARA:GQT-1439-MONOMER.
ARA:GQT-1440-MONOMER.

Miscellaneous databases

PROiO81009.

Gene expression databases

ExpressionAtlasiO81009. baseline and differential.
GenevisibleiO81009. AT.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR001563. Peptidase_S10.
[Graphical view]
PANTHERiPTHR11802. PTHR11802. 1 hit.
PfamiPF00450. Peptidase_S10. 1 hit.
[Graphical view]
PRINTSiPR00724. CRBOXYPTASEC.
SUPFAMiSSF53474. SSF53474. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSCP12_ARATH
AccessioniPrimary (citable) accession number: O81009
Secondary accession number(s): Q3EBW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: November 1, 1998
Last modified: September 7, 2016
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.