Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine carboxypeptidase-like 12

Gene

SCPL12

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Probable carboxypeptidase.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei176By similarity1
Active sitei360By similarity1
Active sitei413By similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionCarboxypeptidase, Hydrolase, Protease

Enzyme and pathway databases

BioCyciARA:AT2G22920-MONOMER

Protein family/group databases

ESTHERiarath-SCP12 Carboxypeptidase_S10
MEROPSiS10.A09

Names & Taxonomyi

Protein namesi
Recommended name:
Serine carboxypeptidase-like 12 (EC:3.4.16.-)
Gene namesi
Name:SCPL12
Ordered Locus Names:At2g22920
ORF Names:T20K9.13
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 2

Organism-specific databases

AraportiAT2G22920
TAIRilocus:2059175 AT2G22920

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000027462622 – 435Serine carboxypeptidase-like 12Add BLAST414

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi80 ↔ 323By similarity
Glycosylationi101N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi244 ↔ 258By similarity
Disulfide bondi282 ↔ 289By similarity
Glycosylationi313N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi336N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi344N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi376N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi420N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO81009
PRIDEiO81009

Expressioni

Tissue specificityi

Expressed in roots.1 Publication

Gene expression databases

ExpressionAtlasiO81009 differential
GenevisibleiO81009 AT

Interactioni

Protein-protein interaction databases

STRINGi3702.AT2G22920.2

Structurei

3D structure databases

ProteinModelPortaliO81009
SMRiO81009
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase S10 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG1282 Eukaryota
COG2939 LUCA
HOGENOMiHOG000198297
InParanoidiO81009
KOiK16296
OrthoDBiEOG093600MP
PhylomeDBiO81009

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR001563 Peptidase_S10
PANTHERiPTHR11802 PTHR11802, 1 hit
PfamiView protein in Pfam
PF00450 Peptidase_S10, 1 hit
PRINTSiPR00724 CRBOXYPTASEC
SUPFAMiSSF53474 SSF53474, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O81009-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKSTPKLLLL LLFIINHHVD SGSIVKFLPG FEGPLPFELE TGYIGIGEEE
60 70 80 90 100
DVQLFYYFIK SERNPKEDPL LLWLSGGPGC SSITGLLFEN GPLALKSKVY
110 120 130 140 150
NGSVPSLVST TYSWTKTANI IFLDQPIGAG FSYSRIPLID TPSDTGEVKN
160 170 180 190 200
IHEFLQKWLS KHPQFSSNPF YASGDSYSGM IVPALVQEIS KGNYICCKPP
210 220 230 240 250
INLQGYILGN PITYFEVDQN YRIPFSHGMA LISDELYESI RRDCKGNYFN
260 270 280 290 300
VDPRNTKCLK LVEEYHKCTD ELNEFNILSP DCDTTSPDCF LYPYYLLGYW
310 320 330 340 350
INDESVRDAL HVNKSSIGKW ERCTYQNRIP YNKDINNSIP YHMNNSISGY
360 370 380 390 400
RSLIYSGDHD LVVPFLATQA WIKSLNYSII HEWRPWMIKD QIAGYTRTYS
410 420 430
NKMTFATVKG SGHTAEYKPN ETFIMFQRWI SGHDL
Length:435
Mass (Da):49,705
Last modified:November 1, 1998 - v1
Checksum:iC6F50A686AD2D617
GO
Isoform 2 (identifier: O81009-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-435: TRTYSNKMTFATVKGSGHTAEYKPNETFIMFQRWISGHDL → IIYFCVIHENLFQ

Note: Derived from EST data. May be due to a competing donor splice site. No experimental confirmation available.
Show »
Length:408
Mass (Da):46,691
Checksum:iBBA69D18EE187E38
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027465396 – 435TRTYS…SGHDL → IIYFCVIHENLFQ in isoform 2. CuratedAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC004786 Genomic DNA Translation: AAC32439.1
CP002685 Genomic DNA Translation: AEC07373.1
CP002685 Genomic DNA Translation: AEC07374.1
PIRiE84618
RefSeqiNP_179876.1, NM_127857.5 [O81009-1]
NP_850033.1, NM_179702.1 [O81009-2]
UniGeneiAt.39371

Genome annotation databases

EnsemblPlantsiAT2G22920.1; AT2G22920.1; AT2G22920 [O81009-2]
AT2G22920.2; AT2G22920.2; AT2G22920 [O81009-1]
GeneIDi816823
GrameneiAT2G22920.1; AT2G22920.1; AT2G22920 [O81009-2]
AT2G22920.2; AT2G22920.2; AT2G22920 [O81009-1]
KEGGiath:AT2G22920

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSCP12_ARATH
AccessioniPrimary (citable) accession number: O81009
Secondary accession number(s): Q3EBW1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: November 1, 1998
Last modified: May 23, 2018
This is version 106 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health