O77746 (PDE5A_CANFA) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 76.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: cGMP-specific 3',5'-cyclic phosphodiesterase EC=3.1.4.35 Alternative name(s): cGMP-binding cGMP-specific phosphodiesterase Short name=CGB-PDE | ||||
| Gene names |
| ||||
| Organism | Canis familiaris (Dog) (Canis lupus familiaris) | ||||
| Taxonomic identifier | 9615 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Laurasiatheria › Carnivora › Caniformia › Canidae › Canis |
Protein attributes
| Sequence length | 865 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. |
| Catalytic activity | Guanosine 3',5'-cyclic phosphate + H2O = guanosine 5'-phosphate. |
| Cofactor | Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity. |
| Enzyme regulation | Inhibited by zaprinast. |
| Pathway | Purine metabolism; 3',5'-cyclic GMP degradation; GMP from 3',5'-cyclic GMP: step 1/1. |
| Subcellular location | Cytoplasm. Cytoplasm › cytosol. Note: PDE5A1 and PDE5A2 are located mostly to soluble cellular fractions and some to particulate cellular fractions. |
| Tissue specificity | Isoform PDE5A1 and isoform PDE5A2 are highly expressed in the cerebellum, hippocampus, retina, lung, heart, spleen, and thoracic artery. Isoform PDE5A1, but not isoform PDE5A2, is also abundantly expressed in the pylorus. |
| Domain | Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain which contains two homologous allosteric cGMP-binding regions, A and B. |
| Post-translational modification | Phosphorylation is regulated by binding of cGMP to the two allosteric sites By similarity. Phosphorylation by PRKG1 leads to its activation By similarity. |
| Miscellaneous | cGMP-binding to the allosteric sites is stimulated by 3-isobutyl-1-methylxanthine (IBMX). |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. Contains 2 GAF domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | Metal-binding Nucleotide-binding cGMP cGMP-binding |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | Allosteric enzyme Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | signal transduction Inferred from electronic annotation. Source: InterPro |
| Cellular component | cytosol Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | 3',5'-cyclic-GMP phosphodiesterase activity Inferred from electronic annotation. Source: EC cGMP bindingInferred from electronic annotation. Source: UniProtKB-KW metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PDE5A1 (identifier: O77746-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PDE5A2 (identifier: O77746-2) The sequence of this isoform differs from the canonical sequence as follows: 1-40: MERGSPGAGAARLPRDQDSVEAWLDDHRDFTFSYFVKKAT → MLPFGHQR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 865 | 865 | cGMP-specific 3',5'-cyclic phosphodiesterase | PRO_0000198822 | |||||
Regions | |||||||||
| Domain | 154 – 304 | 151 | GAF 1 | ||||||
| Domain | 336 – 493 | 158 | GAF 2 | ||||||
| Region | 578 – 843 | 266 | Catalytic By similarity | ||||||
Sites | |||||||||
| Active site | 603 | 1 | Proton donor By similarity | ||||||
| Metal binding | 607 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 643 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 644 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 644 | 1 | Divalent metal cation 2 By similarity | ||||||
| Metal binding | 754 | 1 | Divalent metal cation 1 By similarity | ||||||
| Binding site | 807 | 1 | cGMP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 92 | 1 | Phosphoserine Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 40 | 40 | MERGS…VKKAT → MLPFGHQR in isoform PDE5A2. | VSP_004590 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Novel alternative splice variants of cGMP-binding cGMP-specific phosphodiesterase." Kotera J., Fujishige K., Akatsuka H., Imai Y., Yanaka N., Omori K. J. Biol. Chem. 273:26982-26990(1998) [PubMed: 9756948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PDE5A1 AND PDE5A2). Tissue: Lung. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB008467 mRNA. Translation: BAA33503.1. AB008468 mRNA. Translation: BAA33504.1. |
| RefSeq | NP_001003188.1. NM_001003188.1. |
| UniGene | Cfa.44716. |
3D structure databases | |
| ProteinModelPortal | O77746. |
| SMR | O77746. Positions 154-301, 525-850. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O77746. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 403825. |
| KEGG | cfa:403825. |
Organism-specific databases | |
| CTD | 8654. |
Phylogenomic databases | |
| eggNOG | maNOG05677. |
| GeneTree | ENSGT00550000074280. |
| HOVERGEN | HBG101207. |
| InParanoid | O77746. |
| OrthoDB | EOG4WSW90. |
Family and domain databases | |
| InterPro | IPR003018. GAF. IPR003607. Metal-dep_PHydrolase_HD_dom. IPR023088. PDEase. IPR002073. PDEase_catalytic_dom. IPR023174. PDEase_CS. [Graphical view] |
| Gene3D | G3DSA:1.10.1300.10. PDEase_catalytic_dom. 1 hit. |
| KO | K13762. |
| Pfam | PF01590. GAF. 2 hits. PF00233. PDEase_I. 1 hit. [Graphical view] |
| PRINTS | PR00387. PDIESTERASE1. |
| SMART | SM00065. GAF. 2 hits. SM00471. HDc. 1 hit. [Graphical view] |
| PROSITE | PS00126. PDEASE_I. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | PDE5A_CANFA | ||||||||
| Accession | Primary (citable) accession number: O77746 Secondary accession number(s): O77747 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with