Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Papilin

Gene

mig-6

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Isoform b has a role in post embryonic distal cell tip migration. Essential extracellular matrix (ECM) protein required for hypodermal enclosure in the embryo. Isoform a has a role in embryogenesis, the second phase of distal cell tip migration and is required for distribution of the metalloproteinase, mig-17, during organogenesis.2 Publications

GO - Molecular functioni

GO - Biological processi

  • cell morphogenesis Source: WormBase
  • embryo development ending in birth or egg hatching Source: WormBase
  • embryonic morphogenesis Source: WormBase
  • multicellular organism reproduction Source: WormBase
  • nematode larval development Source: WormBase
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Protease inhibitor, Serine protease inhibitor

Protein family/group databases

MEROPSiI02.968.

Names & Taxonomyi

Protein namesi
Recommended name:
Papilin
Alternative name(s):
Abnormal cell migration protein 6
Gene namesi
Name:mig-6
Synonyms:ppn-1
ORF Names:C37C3.6
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome V

Organism-specific databases

WormBaseiC37C3.6a; CE17535; WBGene00003242; mig-6.
C37C3.6b; CE17536; WBGene00003242; mig-6.
C37C3.6c; CE30735; WBGene00003242; mig-6.

Subcellular locationi

GO - Cellular componenti

  • basement membrane Source: WormBase
Complete GO annotation...

Keywords - Cellular componenti

Basement membrane, Extracellular matrix, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence analysisAdd
BLAST
Chaini20 – 21672148PapilinPRO_0000248545Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi88 ↔ 117By similarity
Disulfide bondi92 ↔ 122By similarity
Disulfide bondi103 ↔ 107By similarity
Glycosylationi268 – 2681N-linked (GlcNAc...)1 Publication
Disulfide bondi353 ↔ 396By similarity
Disulfide bondi357 ↔ 401By similarity
Disulfide bondi368 ↔ 382By similarity
Glycosylationi386 – 3861N-linked (GlcNAc...)2 Publications
Glycosylationi445 – 4451N-linked (GlcNAc...)3 Publications
Glycosylationi541 – 5411N-linked (GlcNAc...)2 Publications
Glycosylationi568 – 5681N-linked (GlcNAc...)2 Publications
Glycosylationi638 – 6381N-linked (GlcNAc...)2 Publications
Glycosylationi715 – 7151N-linked (GlcNAc...)Sequence analysis
Glycosylationi729 – 7291N-linked (GlcNAc...)Sequence analysis
Glycosylationi741 – 7411N-linked (GlcNAc...)Sequence analysis
Glycosylationi814 – 8141N-linked (GlcNAc...)Sequence analysis
Glycosylationi820 – 8201N-linked (GlcNAc...)Sequence analysis
Glycosylationi857 – 8571N-linked (GlcNAc...)3 Publications
Glycosylationi933 – 9331N-linked (GlcNAc...)2 Publications
Disulfide bondi1089 ↔ 1141By similarity
Glycosylationi1090 – 10901N-linked (GlcNAc...)3 Publications
Disulfide bondi1099 ↔ 1124By similarity
Disulfide bondi1116 ↔ 1137By similarity
Disulfide bondi1150 ↔ 1202By similarity
Disulfide bondi1161 ↔ 1185By similarity
Disulfide bondi1177 ↔ 1198By similarity
Disulfide bondi1271 ↔ 1321By similarity
Disulfide bondi1280 ↔ 1304By similarity
Disulfide bondi1296 ↔ 1317By similarity
Disulfide bondi1375 ↔ 1425By similarity
Disulfide bondi1384 ↔ 1408By similarity
Disulfide bondi1400 ↔ 1421By similarity
Disulfide bondi1447 ↔ 1497By similarity
Disulfide bondi1456 ↔ 1480By similarity
Disulfide bondi1472 ↔ 1493By similarity
Disulfide bondi1504 ↔ 1554By similarity
Disulfide bondi1513 ↔ 1537By similarity
Disulfide bondi1529 ↔ 1550By similarity
Disulfide bondi1621 ↔ 1671By similarity
Disulfide bondi1630 ↔ 1654By similarity
Disulfide bondi1646 ↔ 1667By similarity
Disulfide bondi1731 ↔ 1781By similarity
Disulfide bondi1740 ↔ 1764By similarity
Disulfide bondi1756 ↔ 1777By similarity
Disulfide bondi1790 ↔ 1840By similarity
Disulfide bondi1799 ↔ 1823By similarity
Disulfide bondi1815 ↔ 1836By similarity
Glycosylationi1848 – 18481N-linked (GlcNAc...)Sequence analysis
Disulfide bondi1853 ↔ 1903By similarity
Disulfide bondi1862 ↔ 1886By similarity
Disulfide bondi1878 ↔ 1899By similarity
Disulfide bondi1914 ↔ 1964By similarity
Disulfide bondi1923 ↔ 1947By similarity
Disulfide bondi1939 ↔ 1960By similarity
Glycosylationi1992 – 19921N-linked (GlcNAc...)1 Publication
Glycosylationi2087 – 20871N-linked (GlcNAc...)Sequence analysis
Glycosylationi2133 – 21331N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein, Proteoglycan

Proteomic databases

EPDiO76840.
PaxDbiO76840.
PRIDEiO76840.

Expressioni

Tissue specificityi

Isoform a is expressed in body wall muscles and distal cell tips. Isoform b is expressed in embryonic muscles.1 Publication

Gene expression databases

BgeeiWBGene00003242.

Interactioni

Protein-protein interaction databases

BioGridi44205. 13 interactions.
DIPiDIP-24457N.
IntActiO76840. 12 interactions.
MINTiMINT-1044821.
STRINGi6239.C37C3.6b.1.

Structurei

3D structure databases

ProteinModelPortaliO76840.
SMRiO76840. Positions 77-269, 1102-1202, 1263-1568, 1621-1671, 1728-1967.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini76 – 12348TSP type-1 1PROSITE-ProRule annotationAdd
BLAST
Domaini341 – 40262TSP type-1 2PROSITE-ProRule annotationAdd
BLAST
Domaini404 – 45956TSP type-1 3PROSITE-ProRule annotationAdd
BLAST
Domaini461 – 52565TSP type-1 4PROSITE-ProRule annotationAdd
BLAST
Domaini585 – 64359TSP type-1 5PROSITE-ProRule annotationAdd
BLAST
Domaini645 – 70258TSP type-1 6PROSITE-ProRule annotationAdd
BLAST
Domaini1089 – 114153BPTI/Kunitz inhibitor 1PROSITE-ProRule annotationAdd
BLAST
Domaini1150 – 120253BPTI/Kunitz inhibitor 2PROSITE-ProRule annotationAdd
BLAST
Domaini1271 – 132151BPTI/Kunitz inhibitor 3PROSITE-ProRule annotationAdd
BLAST
Domaini1375 – 142551BPTI/Kunitz inhibitor 4PROSITE-ProRule annotationAdd
BLAST
Domaini1447 – 149751BPTI/Kunitz inhibitor 5PROSITE-ProRule annotationAdd
BLAST
Domaini1504 – 155451BPTI/Kunitz inhibitor 6PROSITE-ProRule annotationAdd
BLAST
Domaini1621 – 167151BPTI/Kunitz inhibitor 7PROSITE-ProRule annotationAdd
BLAST
Domaini1731 – 178151BPTI/Kunitz inhibitor 8PROSITE-ProRule annotationAdd
BLAST
Domaini1790 – 184051BPTI/Kunitz inhibitor 9PROSITE-ProRule annotationAdd
BLAST
Domaini1853 – 190351BPTI/Kunitz inhibitor 10PROSITE-ProRule annotationAdd
BLAST
Domaini1914 – 196451BPTI/Kunitz inhibitor 11PROSITE-ProRule annotationAdd
BLAST
Domaini2124 – 216340PLACPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi825 – 1052228Cys-richAdd
BLAST
Compositional biasi1221 – 126545Gln-richAdd
BLAST

Sequence similaritiesi

Contains 11 BPTI/Kunitz inhibitor domains.PROSITE-ProRule annotation
Contains 1 PLAC domain.PROSITE-ProRule annotation
Contains 6 TSP type-1 domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal

Phylogenomic databases

eggNOGiENOG410KCTN. Eukaryota.
ENOG410XQNP. LUCA.
GeneTreeiENSGT00760000118885.
HOGENOMiHOG000021853.
InParanoidiO76840.
OMAiEGCACET.
OrthoDBiEOG091G14M8.
PhylomeDBiO76840.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
4.10.410.10. 11 hits.
InterProiIPR010294. ADAM_spacer1.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR002223. Kunitz_BPTI.
IPR013273. Peptidase_M12B_ADAM-TS.
IPR010909. PLAC.
IPR020901. Prtase_inh_Kunz-CS.
IPR000884. TSP1_rpt.
[Graphical view]
PfamiPF05986. ADAM_spacer1. 1 hit.
PF00014. Kunitz_BPTI. 11 hits.
PF08686. PLAC. 1 hit.
PF00090. TSP_1. 6 hits.
[Graphical view]
PRINTSiPR01857. ADAMTSFAMILY.
PR00759. BASICPTASE.
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 1 hit.
SM00131. KU. 11 hits.
SM00209. TSP1. 7 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
SSF57362. SSF57362. 11 hits.
SSF82895. SSF82895. 6 hits.
PROSITEiPS00280. BPTI_KUNITZ_1. 10 hits.
PS50279. BPTI_KUNITZ_2. 11 hits.
PS50835. IG_LIKE. 1 hit.
PS50900. PLAC. 1 hit.
PS50092. TSP1. 5 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform b (identifier: O76840-1) [UniParc]FASTAAdd to basket
Also known as: mig-6L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLLLFSAAL LLCSVPTWAF SLSSFFGSDV AQKPYLHPNS PPERDPASSR
60 70 80 90 100
MKRQAYQVYV DGDVSVTVDK SGQKETGNWG PWVPENECSR SCGGGVQLEK
110 120 130 140 150
RQCSGDCTGA SVRYISCNLN ACESGTDFRA EQCSKFNDEA LDGNYHKWTP
160 170 180 190 200
YKGKNKCELV CKPESGNFYY KWADKVVDGT KCDSKSNDIC VDGECLPVGC
210 220 230 240 250
DGKLGSSLKF DKCGKCDGDG STCKTIEGRF DERNLSPGYH DIIKLPEGAT
260 270 280 290 300
NIKIQEARKS TNNLALKNGS DHFYLNGNGL IQVEKEVEVG GTIFVYDDAE
310 320 330 340 350
PETLSAQGPL SEELTVALLF RKGSRDTAIK YEFSIPLEEE VDYMYKFDNW
360 370 380 390 400
TPCSVSCGKG VQTRNLYCID GKNKGRVEDD LCEENNATKP EFEKSCETVD
410 420 430 440 450
CEAEWFTGDW ESCSSTCGDQ GQQYRVVYCH QVFANGRRVT VEDGNCTVER
460 470 480 490 500
PPVKQTCNRF ACPEWQAGPW SACSEKCGDA FQYRSVTCRS EKEGEEGKLL
510 520 530 540 550
AADACPADEQ EKFDTERTCN LGPCEGLTFV TGEWNLCTRC NDTEETREVT
560 570 580 590 600
CKDSQGRAYP LEKCLVDNST EIPTDTRSCA TQPPCEYEWT VSEWSKCTTE
610 620 630 640 650
CGHGHKTRRV ICAIHQNGGL EVVDEGHCQA EKPEGKTNCT NEEKCTGTWY
660 670 680 690 700
TSSWSECTAE CGGGSQDRVA VCLNYDKKPV PEWCDEAVKP SEKQDCNVDD
710 720 730 740 750
CPTCVDSEFG CCPDNSTFAT GEFNFGCSNC SETEFGCCAD NVTVATGPNS
760 770 780 790 800
KGCEEFVESP LNLEADVANA DAEASGDAPE LCSVTNENGE AVDVECATIA
810 820 830 840 850
PITALLGDGE LIGNDTDASN ETIHCSKTEF GCCPDWYTAA SGKGNEGCPS
860 870 880 890 900
FTLGGCNETQ FGCCHDDVTL ARGANLEGCG EPSCAASLYG CCKDRKTIAF
910 920 930 940 950
GPHYSGCERS SFPCELSDFG CCPDGETAAL GKNGTGCGEN CLTTKFGCCP
960 970 980 990 1000
DGKTTAKGSH NEGCGCEFAQ YGCCPDGKSV AKGAGFYGCP ESCAQSQFGC
1010 1020 1030 1040 1050
CPDGKTRARG ENKEGCPCQY TRYGCCPDGE TTALGPRNDG CDNCRYAKHG
1060 1070 1080 1090 1100
CCPDGETKAL GPDGAGCPPT TTPPFLMGGT VAPHKIAACN QTQESGTVCG
1110 1120 1130 1140 1150
AGYKLAWHYD TTEGRCNQFW YGGCGGNDNN FASQDMCETI CVEPPGKGRC
1160 1170 1180 1190 1200
YLPRVDGPLR CDQLQPRYYY DHSKKHCVAF WWRGCLGNAN NFNSFEECSM
1210 1220 1230 1240 1250
FCKDVGPYDA PTTAAPPPPP QQNAQQYLPT PEVQQIEIQS AEQPQPQQPQ
1260 1270 1280 1290 1300
QQQQQQQQQP QQPRQSMEDI CRSRQDAGPC ETYSDQWFYN AFSQECETFT
1310 1320 1330 1340 1350
YGGCGGNLNR FRSKDECEQR CFFVHGAQPS AARQEQAQPA AQPAQPAQPS
1360 1370 1380 1390 1400
NIVSPPQQSA SPVVVPSNSK QRDACHLNVD QGRCKGAFDS WYYEVATGSC
1410 1420 1430 1440 1450
VTFKYTGCGG NANRFASKDQ CESLCVKPAS EAASAGIDGA AGINSVCDEA
1460 1470 1480 1490 1500
KDTGPCTNFV TKWYYNKADG TCNRFHYGGC QGTNNRFDNE QQCKAACQNH
1510 1520 1530 1540 1550
KDACQLPKVQ GPCSGKHSYY YYNTASHQCE TFTYGGCLGN TNRFATIEEC
1560 1570 1580 1590 1600
QARCPKDDQT TTTSQPEELP SLPLVQEDPQ PRPAFSLKQS FAHSRRRDAP
1610 1620 1630 1640 1650
FARSVSARHH TPDSEEERVD CYAVPDPGSC GDYRLVWHYS ATSNSCRQFY
1660 1670 1680 1690 1700
YGGCAGNTNR FETRDKCETS CVAKIEERVE SVSEASKSLE EVRLTDPRMD
1710 1720 1730 1740 1750
SHFGYHDPEV DQIEEEAEYV IVDTGALPEL CMLPEQRGSC YDNILRWRFD
1760 1770 1780 1790 1800
SEKSQCVTFM YSGCNPNANH FTSQETCERA CGKWRNVAVC ELPAEHGDCQ
1810 1820 1830 1840 1850
LAIPRWYHDP KTSQCQMMMW TGCGGNGNAF SSKADCESLC RVETLWSNNT
1860 1870 1880 1890 1900
DFCTLERSAG PCTDSISMWY FDSTHLDCKP FTYGGCRGNQ NRFVSKEQCQ
1910 1920 1930 1940 1950
QSCRPGDTKS EDICTLRPEP GPCRLGLEKY FYDPVIQSCH MFHYGGCEGN
1960 1970 1980 1990 2000
ANRFDSELDC FRRCSSVKVE ASESERVGQL TSASTPVIYI VNKTAIFVGN
2010 2020 2030 2040 2050
TFRIRCNSYG VLPITWYKNG GLLQFGSRIT EENDDTLEIV DALTADAGVY
2060 2070 2080 2090 2100
TCIAGQDSTM SEGVEVVIKR LPGHRTTSRP MLTPSKNFSL GTPPTPSPST
2110 2120 2130 2140 2150
VSTTPFRIYT PGSAPSDARV SRPTSNSCMD VGNASTCDLI VKNGLCGKKR
2160
YGTFCCHTCT RVHNFKF
Length:2,167
Mass (Da):237,601
Last modified:November 1, 1998 - v1
Checksum:i96274786D52E3639
GO
Isoform a (identifier: O76840-2) [UniParc]FASTAAdd to basket
Also known as: mig-6S

The sequence of this isoform differs from the canonical sequence as follows:
     1556-1558: KDD → SKF
     1559-2167: Missing.

Show »
Length:1,558
Mass (Da):169,604
Checksum:i38FCAA2CA6B80D6B
GO
Isoform c (identifier: O76840-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1367-1438: SNSKQRDACHLNVDQGRCKGAFDSWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLCVKPASEAASAGID → Y
     1556-1558: KDD → SKF
     1559-2167: Missing.

Note: No experimental confirmation available.
Show »
Length:1,487
Mass (Da):162,109
Checksum:i3DB432B96B90FD4E
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1367 – 143872SNSKQ…SAGID → Y in isoform c. CuratedVSP_020307Add
BLAST
Alternative sequencei1556 – 15583KDD → SKF in isoform a and isoform c. CuratedVSP_020308
Alternative sequencei1559 – 2167609Missing in isoform a and isoform c. CuratedVSP_020309Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FO080808 Genomic DNA. Translation: CCD66947.1.
FO080808 Genomic DNA. Translation: CCD66945.1.
FO080808 Genomic DNA. Translation: CCD66946.1.
PIRiC89114.
T34395.
RefSeqiNP_505017.1. NM_072616.4. [O76840-1]
NP_505018.1. NM_072617.4. [O76840-2]
NP_741569.1. NM_171931.4. [O76840-3]
UniGeneiCel.17525.

Genome annotation databases

EnsemblMetazoaiC37C3.6b.1; C37C3.6b.1; WBGene00003242. [O76840-1]
C37C3.6b.2; C37C3.6b.2; WBGene00003242. [O76840-1]
GeneIDi179162.
KEGGicel:CELE_C37C3.6.
UCSCiC37C3.6a.2. c. elegans. [O76840-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FO080808 Genomic DNA. Translation: CCD66947.1.
FO080808 Genomic DNA. Translation: CCD66945.1.
FO080808 Genomic DNA. Translation: CCD66946.1.
PIRiC89114.
T34395.
RefSeqiNP_505017.1. NM_072616.4. [O76840-1]
NP_505018.1. NM_072617.4. [O76840-2]
NP_741569.1. NM_171931.4. [O76840-3]
UniGeneiCel.17525.

3D structure databases

ProteinModelPortaliO76840.
SMRiO76840. Positions 77-269, 1102-1202, 1263-1568, 1621-1671, 1728-1967.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi44205. 13 interactions.
DIPiDIP-24457N.
IntActiO76840. 12 interactions.
MINTiMINT-1044821.
STRINGi6239.C37C3.6b.1.

Protein family/group databases

MEROPSiI02.968.

Proteomic databases

EPDiO76840.
PaxDbiO76840.
PRIDEiO76840.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiC37C3.6b.1; C37C3.6b.1; WBGene00003242. [O76840-1]
C37C3.6b.2; C37C3.6b.2; WBGene00003242. [O76840-1]
GeneIDi179162.
KEGGicel:CELE_C37C3.6.
UCSCiC37C3.6a.2. c. elegans. [O76840-1]

Organism-specific databases

CTDi179162.
WormBaseiC37C3.6a; CE17535; WBGene00003242; mig-6.
C37C3.6b; CE17536; WBGene00003242; mig-6.
C37C3.6c; CE30735; WBGene00003242; mig-6.

Phylogenomic databases

eggNOGiENOG410KCTN. Eukaryota.
ENOG410XQNP. LUCA.
GeneTreeiENSGT00760000118885.
HOGENOMiHOG000021853.
InParanoidiO76840.
OMAiEGCACET.
OrthoDBiEOG091G14M8.
PhylomeDBiO76840.

Miscellaneous databases

PROiO76840.

Gene expression databases

BgeeiWBGene00003242.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
4.10.410.10. 11 hits.
InterProiIPR010294. ADAM_spacer1.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR002223. Kunitz_BPTI.
IPR013273. Peptidase_M12B_ADAM-TS.
IPR010909. PLAC.
IPR020901. Prtase_inh_Kunz-CS.
IPR000884. TSP1_rpt.
[Graphical view]
PfamiPF05986. ADAM_spacer1. 1 hit.
PF00014. Kunitz_BPTI. 11 hits.
PF08686. PLAC. 1 hit.
PF00090. TSP_1. 6 hits.
[Graphical view]
PRINTSiPR01857. ADAMTSFAMILY.
PR00759. BASICPTASE.
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 1 hit.
SM00131. KU. 11 hits.
SM00209. TSP1. 7 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
SSF57362. SSF57362. 11 hits.
SSF82895. SSF82895. 6 hits.
PROSITEiPS00280. BPTI_KUNITZ_1. 10 hits.
PS50279. BPTI_KUNITZ_2. 11 hits.
PS50835. IG_LIKE. 1 hit.
PS50900. PLAC. 1 hit.
PS50092. TSP1. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPPN1_CAEEL
AccessioniPrimary (citable) accession number: O76840
Secondary accession number(s): Q22911, Q8I7I0, Q8MPV5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: November 1, 1998
Last modified: September 7, 2016
This is version 126 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.