O76095 (JTB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein JTB Alternative name(s): Jumping translocation breakpoint protein Prostate androgen-regulated protein Short name=PAR protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 146 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Increases AURKB activity. Inhibits apoptosis induced by TGFB1 By similarity. Overexpression induces swelling of mitochondria and reduces mitochondrial membrane potential By similarity. Ref.12 |
| Subunit structure | Interacts with AURKA, AURKB, BIRC5 and INCENP. May be a component of the CPC at least composed of BIRC5/survivin, CDCA8/borealin, INCENP and AURKB/Aurora-B. Ref.12 |
| Subcellular location | Membrane; Single-pass type I membrane protein Potential. Mitochondrion By similarity. Cytoplasm. Cytoplasm › cytoskeleton › centrosome. Cytoplasm › cytoskeleton › spindle. Note: Detected at the centrosome and along spindle fibers during prophase and metaphase. Detected at the midbody during telophase. Ref.1 Ref.12 |
| Tissue specificity | Ubiquitous. Expressed in all normal human tissues studied but overexpressed or underexpressed in many of their malignant counterparts. Ref.1 Ref.2 Ref.11 Ref.12 |
| Induction | Protein levels increase during the S phase of the cell cycle, are highest during G2 and mitosis, and decrease to low levels at G1. Levels are lowest at the transition from G1 to S phase. Ref.12 |
| Sequence similarities | Belongs to the JTB family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O76095-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O76095-2) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEK → MAWGWHLSF |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 30 | 30 | Potential | |||||||||||||||||||||
| Chain | 31 – 146 | 116 | Protein JTB | PRO_0000021535 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Topological domain | 31 – 105 | 75 | Extracellular Potential | |||||||||||||||||||||
| Transmembrane | 106 – 126 | 21 | Helical; Potential | |||||||||||||||||||||
| Topological domain | 127 – 146 | 20 | Cytoplasmic Potential | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 1 – 38 | 38 | MLAGA…VQEEK → MAWGWHLSF in isoform 2. | VSP_041400 | ||||||||||||||||||||
| Natural variant | 16 | 1 | L → F. Corresponds to variant rs34686244 [ dbSNP | Ensembl ]. | VAR_033994 | ||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Turn | 49 – 51 | 3 | ||||||||||||||||||||||
| Beta strand | 54 – 62 | 9 | ||||||||||||||||||||||
| Helix | 65 – 70 | 6 | ||||||||||||||||||||||
| Helix | 72 – 74 | 3 | ||||||||||||||||||||||
| Turn | 75 – 77 | 3 | ||||||||||||||||||||||
| Beta strand | 79 – 85 | 7 | ||||||||||||||||||||||
| Turn | 86 – 89 | 4 | ||||||||||||||||||||||
| Beta strand | 90 – 95 | 6 | ||||||||||||||||||||||
| Helix | 98 – 101 | 4 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "JTB: a novel membrane protein gene at 1q21 rearranged in a jumping translocation." Hatakeyama S., Osawa M., Omine M., Ishikawa F. Oncogene 18:2085-2090(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "PAR, a novel androgen regulated gene, ubiquitously expressed in normal and malignant cells." Platica O., Chen S., Ivan E., Lopingco M.C., Holland J.F., Platica M. Int. J. Oncol. 16:1055-1061(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Mammary cancer and Prostatic carcinoma. |
| [3] | Mei G., Yu W., Gibbs R.A. Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Umbilical cord blood. |
| [5] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Tongue. |
| [8] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Cervix, Lung, Skin and Uterus. |
| [11] | "Characterization of Jumping translocation breakpoint (JTB) gene product isolated as a TGF-beta1-inducible clone involved in regulation of mitochondrial function, cell growth and cell death." Kanome T., Itoh N., Ishikawa F., Mori K., Kim-Kaneyama J.R., Nose K., Shibanuma M. Oncogene 26:5991-6001(2007) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [12] | "PAR, a protein involved in the cell cycle, is functionally related to chromosomal passenger proteins." Platica M., Ionescu A., Ivan E., Holland J.F., Mandeli J., Platica O. Int. J. Oncol. 38:777-785(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH AURKA; AURKB AND BIRC5, SUBUNIT, INDUCTION, TISSUE SPECIFICITY. |
| [13] | "The structure of the extracellular domain of the jumping translocation breakpoint protein reveals a variation of the midkine fold." Rousseau F., Pan B., Fairbrother W.J., Bazan J.F., Lingel A. J. Mol. Biol. 415:22-28(2012) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 47-104. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB016492 Genomic DNA. Translation: BAA33735.1. AB016488 mRNA. Translation: BAA33731.1. AB016493 Genomic DNA. Translation: BAA33736.1. AF115850 mRNA. Translation: AAD09822.2. AF131797 mRNA. Translation: AAD20045.1. AF151056 mRNA. Translation: AAF36142.1. BT007285 mRNA. Translation: AAP35949.1. CR456985 mRNA. Translation: CAG33266.1. AK312106 mRNA. Translation: BAG35042.1. AL358472 Genomic DNA. Translation: CAI14028.1. AL358472 Genomic DNA. Translation: CAI14029.1. AL358472 Genomic DNA. Translation: CAI14030.1. CH471121 Genomic DNA. Translation: EAW53241.1. CH471121 Genomic DNA. Translation: EAW53242.1. CH471121 Genomic DNA. Translation: EAW53244.1. BC000499 mRNA. Translation: AAH00499.1. BC000996 mRNA. Translation: AAH00996.1. BC001363 mRNA. Translation: AAH01363.1. BC001667 mRNA. Translation: AAH01667.1. BC004239 mRNA. Translation: AAH04239.1. BC019277 mRNA. Translation: AAH19277.1. | ||||||||||||
| IPI | IPI00000912. IPI00008833. | ||||||||||||
| RefSeq | NP_006685.1. NM_006694.3. | ||||||||||||
| UniGene | Hs.6396. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O76095. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O76095. 5 interactions. | ||||||||||||
| STRING | 9606.ENSP00000271843. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O76095. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O76095. | ||||||||||||
| PRIDE | O76095. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 10899. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000271843; ENSP00000271843; ENSG00000143543. ENST00000356648; ENSP00000349069; ENSG00000143543. ENST00000368589; ENSP00000357578; ENSG00000143543. ENST00000428469; ENSP00000395250; ENSG00000143543. | ||||||||||||
| GeneID | 10899. | ||||||||||||
| KEGG | hsa:10899. | ||||||||||||
| UCSC | uc001fds.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 10899. | ||||||||||||
| GeneCards | GC01M153946. | ||||||||||||
| HGNC | HGNC:6201. JTB. | ||||||||||||
| HPA | HPA006514. | ||||||||||||
| MIM | 604671. gene. | ||||||||||||
| neXtProt | NX_O76095. | ||||||||||||
| PharmGKB | PA30003. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG296098. | ||||||||||||
| HOGENOM | HOG000294204. | ||||||||||||
| HOVERGEN | HBG000952. | ||||||||||||
| InParanoid | O76095. | ||||||||||||
| OMA | TPECGST. | ||||||||||||
| OrthoDB | EOG49S67M. | ||||||||||||
| PhylomeDB | O76095. | ||||||||||||
Gene expression databases | |||||||||||||
| Bgee | O76095. | ||||||||||||
| CleanEx | HS_JTB. | ||||||||||||
| Genevestigator | O76095. | ||||||||||||
| GermOnline | ENSG00000143543. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR008657. JTB. [Graphical view] | ||||||||||||
| PANTHER | PTHR13041. PTHR13041. 1 hit. | ||||||||||||
| Pfam | PF05439. JTB. 1 hit. [Graphical view] | ||||||||||||
| ProDom | PD151382. JTB. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | O76095. | ||||||||||||
| GenomeRNAi | 10899. | ||||||||||||
| NextBio | 41391. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | JTB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O76095 Secondary accession number(s): O95442, Q6IB19, Q9P0Q4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
