Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O76095 (JTB_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 111. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein JTB
Alternative name(s):
Jumping translocation breakpoint protein
Prostate androgen-regulated protein
Short name=PAR protein
Gene names
Name:JTB
ORF Names:HSPC222
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length146 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Increases AURKB activity. Inhibits apoptosis induced by TGFB1 By similarity. Overexpression induces swelling of mitochondria and reduces mitochondrial membrane potential By similarity. Ref.12

Subunit structure

Interacts with AURKA, AURKB, BIRC5 and INCENP. May be a component of the CPC at least composed of BIRC5/survivin, CDCA8/borealin, INCENP and AURKB/Aurora-B. Ref.12

Subcellular location

Membrane; Single-pass type I membrane protein Potential. Mitochondrion By similarity. Cytoplasm. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Cytoplasmcytoskeletonspindle. Note: Detected at the centrosome and along spindle fibers during prophase and metaphase. Detected at the midbody during telophase. Ref.1 Ref.12

Tissue specificity

Ubiquitous. Expressed in all normal human tissues studied but overexpressed or underexpressed in many of their malignant counterparts. Ref.1 Ref.2 Ref.11 Ref.12

Induction

Protein levels increase during the S phase of the cell cycle, are highest during G2 and mitosis, and decrease to low levels at G1. Levels are lowest at the transition from G1 to S phase. Ref.12

Sequence similarities

Belongs to the JTB family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O76095-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O76095-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEK → MAWGWHLSF

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3030 Potential
Chain31 – 146116Protein JTB
PRO_0000021535

Regions

Topological domain31 – 10575Extracellular Potential
Transmembrane106 – 12621Helical; Potential
Topological domain127 – 14620Cytoplasmic Potential

Natural variations

Alternative sequence1 – 3838MLAGA…VQEEK → MAWGWHLSF in isoform 2.
VSP_041400
Natural variant161L → F.
Corresponds to variant rs34686244 [ dbSNP | Ensembl ].
VAR_033994

Secondary structure

................ 146
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1998. Version 1.
Checksum: CA7080543591C319

FASTA14616,358
        10         20         30         40         50         60 
MLAGAGRPGL PQGRHLCWLL CAFTLKLCQA EAPVQEEKLS ASTSNLPCWL VEEFVVAEEC 

        70         80         90        100        110        120 
SPCSNFRAKT TPECGPTGYV EKITCSSSKR NEFKSCRSAL MEQRLFWKFE GAVVCVALIF 

       130        140 
ACLVIIRQRQ LDRKALEKVR KQIESI 

« Hide

Isoform 2 [UniParc].

Checksum: 39BB62469FA5541B
Show »

FASTA11713,356

References

« Hide 'large scale' references
[1]"JTB: a novel membrane protein gene at 1q21 rearranged in a jumping translocation."
Hatakeyama S., Osawa M., Omine M., Ishikawa F.
Oncogene 18:2085-2090(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[2]"PAR, a novel androgen regulated gene, ubiquitously expressed in normal and malignant cells."
Platica O., Chen S., Ivan E., Lopingco M.C., Holland J.F., Platica M.
Int. J. Oncol. 16:1055-1061(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Mammary cancer and Prostatic carcinoma.
[3]Mei G., Yu W., Gibbs R.A.
Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[4]"Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. expand/collapse author list , Gu J., Chen S.-J., Chen Z.
Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Umbilical cord blood.
[5]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[6]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[7]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Tongue.
[8]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Cervix, Lung, Skin and Uterus.
[11]"Characterization of Jumping translocation breakpoint (JTB) gene product isolated as a TGF-beta1-inducible clone involved in regulation of mitochondrial function, cell growth and cell death."
Kanome T., Itoh N., Ishikawa F., Mori K., Kim-Kaneyama J.R., Nose K., Shibanuma M.
Oncogene 26:5991-6001(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[12]"PAR, a protein involved in the cell cycle, is functionally related to chromosomal passenger proteins."
Platica M., Ionescu A., Ivan E., Holland J.F., Mandeli J., Platica O.
Int. J. Oncol. 38:777-785(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH AURKA; AURKB AND BIRC5, SUBUNIT, INDUCTION, TISSUE SPECIFICITY.
[13]"The structure of the extracellular domain of the jumping translocation breakpoint protein reveals a variation of the midkine fold."
Rousseau F., Pan B., Fairbrother W.J., Bazan J.F., Lingel A.
J. Mol. Biol. 415:22-28(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 47-104.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB016492 Genomic DNA. Translation: BAA33735.1.
AB016488 mRNA. Translation: BAA33731.1.
AB016493 Genomic DNA. Translation: BAA33736.1.
AF115850 mRNA. Translation: AAD09822.2.
AF131797 mRNA. Translation: AAD20045.1.
AF151056 mRNA. Translation: AAF36142.1.
BT007285 mRNA. Translation: AAP35949.1.
CR456985 mRNA. Translation: CAG33266.1.
AK312106 mRNA. Translation: BAG35042.1.
AL358472 Genomic DNA. Translation: CAI14028.1.
AL358472 Genomic DNA. Translation: CAI14029.1.
AL358472 Genomic DNA. Translation: CAI14030.1.
CH471121 Genomic DNA. Translation: EAW53241.1.
CH471121 Genomic DNA. Translation: EAW53242.1.
CH471121 Genomic DNA. Translation: EAW53244.1.
BC000499 mRNA. Translation: AAH00499.1.
BC000996 mRNA. Translation: AAH00996.1.
BC001363 mRNA. Translation: AAH01363.1.
BC001667 mRNA. Translation: AAH01667.1.
BC004239 mRNA. Translation: AAH04239.1.
BC019277 mRNA. Translation: AAH19277.1.
RefSeqNP_006685.1. NM_006694.3.
UniGeneHs.6396.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2KJXNMR-A47-104[»]
ProteinModelPortalO76095.
SMRO76095. Positions 46-104.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116105. 4 interactions.
IntActO76095. 6 interactions.
MINTMINT-8247506.
STRING9606.ENSP00000271843.

PTM databases

PhosphoSiteO76095.

Proteomic databases

PaxDbO76095.
PRIDEO76095.

Protocols and materials databases

DNASU10899.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000271843; ENSP00000271843; ENSG00000143543. [O76095-1]
ENST00000356648; ENSP00000349069; ENSG00000143543. [O76095-2]
ENST00000368589; ENSP00000357578; ENSG00000143543. [O76095-2]
ENST00000428469; ENSP00000395250; ENSG00000143543. [O76095-2]
GeneID10899.
KEGGhsa:10899.
UCSCuc001fds.3. human. [O76095-1]

Organism-specific databases

CTD10899.
GeneCardsGC01M153946.
HGNCHGNC:6201. JTB.
HPAHPA006514.
MIM604671. gene.
neXtProtNX_O76095.
PharmGKBPA30003.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG296098.
HOGENOMHOG000294204.
HOVERGENHBG000952.
InParanoidO76095.
OMATPECGST.
OrthoDBEOG7SR4Q2.
PhylomeDBO76095.
TreeFamTF316934.

Gene expression databases

BgeeO76095.
CleanExHS_JTB.
GenevestigatorO76095.

Family and domain databases

InterProIPR008657. JTB.
[Graphical view]
PANTHERPTHR13041:SF0. PTHR13041:SF0. 1 hit.
PfamPF05439. JTB. 1 hit.
[Graphical view]
ProDomPD151382. JTB. 1 hit.
[Graphical view] [Entries sharing at least one domain]
ProtoNetSearch...

Other

EvolutionaryTraceO76095.
GeneWikiJTB_(gene).
GenomeRNAi10899.
NextBio41391.
PROO76095.
SOURCESearch...

Entry information

Entry nameJTB_HUMAN
AccessionPrimary (citable) accession number: O76095
Secondary accession number(s): O95442, Q6IB19, Q9P0Q4
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: April 16, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM