Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O76083

- PDE9A_HUMAN

UniProt

O76083 - PDE9A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

Gene

PDE9A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Hydrolyzes the second messenger cGMP, which is a key regulator of many important physiological processes.1 Publication

Catalytic activityi

Guanosine 3',5'-cyclic phosphate + H2O = guanosine 5'-phosphate.

Cofactori

Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.1 Publication

Enzyme regulationi

Inhibited by zaprinast.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei312 – 3121Proton donor
Metal bindingi316 – 3161Divalent metal cation 1
Metal bindingi352 – 3521Divalent metal cation 1
Metal bindingi353 – 3531Divalent metal cation 1
Metal bindingi353 – 3531Divalent metal cation 2
Binding sitei353 – 3531cGMP1 Publication
Metal bindingi462 – 4621Divalent metal cation 1
Binding sitei462 – 4621cGMP1 Publication
Binding sitei484 – 4841cGMP1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi312 – 3165cGMP1 Publication
Nucleotide bindingi512 – 5132cGMP1 Publication

GO - Molecular functioni

  1. 3',5'-cyclic-GMP phosphodiesterase activity Source: UniProtKB-EC
  2. 3',5'-cyclic-nucleotide phosphodiesterase activity Source: ProtInc
  3. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. blood coagulation Source: Reactome
  2. cGMP-mediated signaling Source: Ensembl
  3. metabolic process Source: GOC
  4. signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

cGMP, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_23767. cGMP effects.

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A (EC:3.1.4.35)
Gene namesi
Name:PDE9A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 21

Organism-specific databases

HGNCiHGNC:8795. PDE9A.

Subcellular locationi

GO - Cellular componenti

  1. cell projection Source: UniProtKB-KW
  2. cytosol Source: UniProtKB
  3. endoplasmic reticulum Source: UniProtKB-KW
  4. Golgi apparatus Source: UniProtKB-KW
  5. perikaryon Source: Ensembl
  6. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi312 – 3121H → A: Completely abolishes catalytic activity. 1 Publication
Mutagenesisi356 – 3561H → A: Reduces catalytic activity, but has no effect on substrate affinity. 1 Publication

Organism-specific databases

PharmGKBiPA33143.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 593593High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9APRO_0000198841Add
BLAST

Proteomic databases

PaxDbiO76083.
PRIDEiO76083.

PTM databases

PhosphoSiteiO76083.

Expressioni

Tissue specificityi

Expressed in all tissues examined (testis, brain, small intestine, skeletal muscle, heart, lung, thymus, spleen, placenta, kidney, liver, pancreas, ovary and prostate) except blood. Highest levels in brain, heart, kidney, spleen, prostate and colon. Isoform PDE9A12 is found in prostate.1 Publication

Gene expression databases

BgeeiO76083.
GenevestigatoriO76083.

Organism-specific databases

HPAiHPA011380.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TRIM32Q130493EBI-742764,EBI-742790

Protein-protein interaction databases

BioGridi111178. 4 interactions.
IntActiO76083. 2 interactions.
MINTiMINT-1444906.

Structurei

Secondary structure

1
593
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi250 – 2556
Helixi263 – 2653
Helixi268 – 28114
Helixi284 – 2885
Helixi292 – 30514
Beta strandi310 – 3134
Helixi314 – 33017
Helixi333 – 3364
Helixi339 – 35113
Turni352 – 3554
Helixi361 – 3677
Helixi370 – 3756
Helixi380 – 39314
Helixi396 – 3983
Turni400 – 4034
Helixi406 – 42217
Helixi425 – 4273
Helixi428 – 43912
Helixi447 – 46216
Helixi465 – 4673
Helixi470 – 49425
Helixi500 – 5023
Turni504 – 5063
Helixi509 – 51911
Helixi521 – 53111
Helixi535 – 56127
Beta strandi562 – 5643

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2HD1X-ray2.23A/B241-566[»]
2YY2X-ray2.80A/B241-566[»]
3DY8X-ray2.15A/B242-566[»]
3DYLX-ray2.70A/B242-566[»]
3DYNX-ray2.10A/B242-566[»]
3DYQX-ray2.50A/B242-566[»]
3DYSX-ray2.30A/B242-566[»]
3JSIX-ray2.72A/B242-566[»]
3JSWX-ray2.30A/B242-566[»]
3K3EX-ray2.70A/B241-566[»]
3K3HX-ray2.50A/B241-566[»]
3N3ZX-ray2.75A/B241-566[»]
3QI3X-ray2.30A/B1-593[»]
3QI4X-ray2.50A/B1-593[»]
4E90X-ray2.50A/B242-566[»]
4G2JX-ray2.40A/B242-566[»]
4G2LX-ray3.00A/B242-566[»]
4GH6X-ray2.70A/B241-566[»]
ProteinModelPortaliO76083.
SMRiO76083. Positions 242-565.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO76083.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni288 – 550263CatalyticBy similarityAdd
BLAST

Domaini

Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG268427.
GeneTreeiENSGT00760000118889.
HOVERGENiHBG053545.
KOiK13761.
OMAiPRAFKIN.
OrthoDBiEOG7DFXC4.
PhylomeDBiO76083.
TreeFamiTF314638.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (16)i

Sequence statusi: Complete.

This entry describes 16 isoformsi produced by alternative splicing. Align

Isoform PDE9A1 (identifier: O76083-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSGSSSYRP KAIYLDIDGR IQKVIFSKYC NSSDIMDLFC IATGLPRNTT
60 70 80 90 100
ISLLTTDDAM VSIDPTMPAN SERTPYKVRP VAIKQLSAGV EDKRTTSRGQ
110 120 130 140 150
SAERPLRDRR VVGLEQPRRE GAFESGQVEP RPREPQGCYQ EGQRIPPERE
160 170 180 190 200
ELIQSVLAQV AEQFSRAFKI NELKAEVANH LAVLEKRVEL EGLKVVEIEK
210 220 230 240 250
CKSDIKKMRE ELAARSSRTN CPCKYSFLDN HKKLTPRRDV PTYPKYLLSP
260 270 280 290 300
ETIEALRKPT FDVWLWEPNE MLSCLEHMYH DLGLVRDFSI NPVTLRRWLF
310 320 330 340 350
CVHDNYRNNP FHNFRHCFCV AQMMYSMVWL CSLQEKFSQT DILILMTAAI
360 370 380 390 400
CHDLDHPGYN NTYQINARTE LAVRYNDISP LENHHCAVAF QILAEPECNI
410 420 430 440 450
FSNIPPDGFK QIRQGMITLI LATDMARHAE IMDSFKEKME NFDYSNEEHM
460 470 480 490 500
TLLKMILIKC CDISNEVRPM EVAEPWVDCL LEEYFMQSDR EKSEGLPVAP
510 520 530 540 550
FMDRDKVTKA TAQIGFIKFV LIPMFETVTK LFPMVEEIML QPLWESRDRY
560 570 580 590
EELKRIDDAM KELQKKTDSL TSGATEKSRE RSRDVKNSEG DCA
Length:593
Mass (Da):68,493
Last modified:November 1, 1998 - v1
Checksum:iE2731C7C828C0994
GO
Isoform PDE9A2 (identifier: O76083-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-147: Missing.

Show »
Length:533
Mass (Da):61,709
Checksum:i728ADAAACE0E4D29
GO
Isoform PDE9A3 (identifier: O76083-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MGSGSSSYRP...DPTMPANSER → MDAFRS
     88-147: Missing.

Show »
Length:466
Mass (Da):54,440
Checksum:iDE087DD09AAF4794
GO
Isoform PDE9A4 (identifier: O76083-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-165: VIFSKYCNSS...VLAQVAEQFS → HSVQSETCGHQATL

Show »
Length:465
Mass (Da):54,096
Checksum:iBDD6A8F85E591A67
GO
Isoform PDE9A5 (identifier: O76083-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-165: TPYKVRPVAI...VLAQVAEQFS → NELILYTSLR...SETCGHQATL

Show »
Length:540
Mass (Da):62,491
Checksum:i612A2ECEE7F656B4
GO
Isoform PDE9A6 (identifier: O76083-6) [UniParc]FASTAAdd to Basket

Also known as: PDE9A5

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR
     88-147: Missing.

Show »
Length:492
Mass (Da):57,285
Checksum:i1FE4F709AD50C0E6
GO
Isoform PDE9A7 (identifier: O76083-7) [UniParc]FASTAAdd to Basket

Also known as: PDE9A8, PDE9A14, PDE9A19, PDE9A20

The sequence of this isoform differs from the canonical sequence as follows:
     1-207: Missing.

Show »
Length:386
Mass (Da):45,290
Checksum:i4120AB778B9746B9
GO
Isoform PDE9A9 (identifier: O76083-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-73: Missing.
     88-147: Missing.

Show »
Length:507
Mass (Da):58,933
Checksum:iE211E0EB8B67F284
GO
Isoform PDE9A10 (identifier: O76083-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-160: Missing.
     161-165: AEQFS → MDAFR

Show »
Length:433
Mass (Da):50,713
Checksum:iD6036BB3CA9FB7B2
GO
Isoform PDE9A11 (identifier: O76083-10) [UniParc]FASTAAdd to Basket

Also known as: PDE9A15

The sequence of this isoform differs from the canonical sequence as follows:
     1-217: Missing.
     218-218: R → M

Show »
Length:376
Mass (Da):44,134
Checksum:iBF896546AED87831
GO
Isoform PDE9A12 (identifier: O76083-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR
     73-165: Missing.

Show »
Length:459
Mass (Da):53,489
Checksum:iE7DA06012931A850
GO
Isoform PDE9A13 (identifier: O76083-12) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-165: VIFSKYCNSS...VLAQVAEQFS → EHDHLPADHR...SETCGHQATL

Show »
Length:491
Mass (Da):57,350
Checksum:iCA53A1793F405CDB
GO
Isoform PDE9A16 (identifier: O76083-13) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MGSGSSSYRP...DPTMPANSER → MDAFRS

Show »
Length:526
Mass (Da):61,223
Checksum:i02A36AE5185CEDF3
GO
Isoform PDE9A17 (identifier: O76083-14) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR

Show »
Length:552
Mass (Da):64,068
Checksum:iF10D41FE319A6D28
GO
Isoform PDE9A18 (identifier: O76083-15) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-73: Missing.

Show »
Length:567
Mass (Da):65,717
Checksum:i2DFEB16AFCA94F0D
GO
Isoform PDE9A21 (identifier: O76083-16) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MGSGSSSYRP...DPTMPANSER → MSSFSIHHSVTCCFYLVRSHGRPTS
     88-147: Missing.

Show »
Length:485
Mass (Da):56,554
Checksum:i82275A46E46C4D83
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti79 – 791R → G in BAG57446. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 217217Missing in isoform PDE9A11. 1 PublicationVSP_017302Add
BLAST
Alternative sequencei1 – 207207Missing in isoform PDE9A7. 1 PublicationVSP_017303Add
BLAST
Alternative sequencei1 – 160160Missing in isoform PDE9A10. 1 PublicationVSP_017304Add
BLAST
Alternative sequencei1 – 7373MGSGS…ANSER → MSSFSIHHSVTCCFYLVRSH GRPTS in isoform PDE9A21. 1 PublicationVSP_038647Add
BLAST
Alternative sequencei1 – 7373MGSGS…ANSER → MDAFRS in isoform PDE9A3 and isoform PDE9A16. 3 PublicationsVSP_004598Add
BLAST
Alternative sequencei1 – 4646MGSGS…ATGLP → MDAFR in isoform PDE9A6, isoform PDE9A12 and isoform PDE9A17. 2 PublicationsVSP_017305Add
BLAST
Alternative sequencei24 – 165142VIFSK…AEQFS → EHDHLPADHRRRHGLHRPHH AREFRTHSVQSETCGHQATL in isoform PDE9A13. 1 PublicationVSP_017306Add
BLAST
Alternative sequencei24 – 165142VIFSK…AEQFS → HSVQSETCGHQATL in isoform PDE9A4. 1 PublicationVSP_004600Add
BLAST
Alternative sequencei48 – 7326Missing in isoform PDE9A9 and isoform PDE9A18. 1 PublicationVSP_017307Add
BLAST
Alternative sequencei73 – 16593Missing in isoform PDE9A12. 1 PublicationVSP_017308Add
BLAST
Alternative sequencei74 – 16592TPYKV…AEQFS → NELILYTSLRNLLFLPSKES WASHQHSVQSETCGHQATL in isoform PDE9A5. 1 PublicationVSP_017309Add
BLAST
Alternative sequencei88 – 14760Missing in isoform PDE9A2, isoform PDE9A3, isoform PDE9A6, isoform PDE9A9 and isoform PDE9A21. 7 PublicationsVSP_004599Add
BLAST
Alternative sequencei161 – 1655AEQFS → MDAFR in isoform PDE9A10. 1 PublicationVSP_017310
Alternative sequencei218 – 2181R → M in isoform PDE9A11. 1 PublicationVSP_017311

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF048837 mRNA. Translation: AAC39778.1.
AB017602 Genomic DNA. Translation: BAA88847.1.
AF067223 mRNA. Translation: AAC26723.1.
AF067224 mRNA. Translation: AAC26724.1.
AF067225 mRNA. Translation: AAC26725.1.
AF067226 mRNA. Translation: AAC26726.1.
AY196299 mRNA. Translation: AAO34685.1.
AY196300 mRNA. Translation: AAO34686.1.
AY196301 mRNA. Translation: AAO34687.1.
AY196302 mRNA. Translation: AAO34688.1.
AY196303 mRNA. Translation: AAO34689.1.
AY196304 mRNA. Translation: AAO34690.1.
AY196305 mRNA. Translation: AAO34691.1.
AY196306 mRNA. Translation: AAO34692.1.
AY196307 mRNA. Translation: AAO34693.1.
AY196308 mRNA. Translation: AAO34694.1.
AY196309 mRNA. Translation: AAO34695.1.
AY196310 mRNA. Translation: AAO34696.1.
AY196311 mRNA. Translation: AAO34697.1.
AY196312 mRNA. Translation: AAO34698.1.
AY196313 mRNA. Translation: AAO34699.1.
AY196314 mRNA. Translation: AAO34700.1.
AY242121 mRNA. Translation: AAO88210.1.
AY701187 mRNA. Translation: AAV84271.1.
AK294112 mRNA. Translation: BAG57446.1.
AK314679 mRNA. Translation: BAG37232.1.
BT007016 mRNA. Translation: AAP35662.1.
AP001747 Genomic DNA. Translation: BAA95552.1.
CH471079 Genomic DNA. Translation: EAX09544.1.
CH471079 Genomic DNA. Translation: EAX09536.1.
CH471079 Genomic DNA. Translation: EAX09537.1.
CH471079 Genomic DNA. Translation: EAX09541.1.
CH471079 Genomic DNA. Translation: EAX09542.1.
CH471079 Genomic DNA. Translation: EAX09546.1.
CH471079 Genomic DNA. Translation: EAX09540.1.
CH471079 Genomic DNA. Translation: EAX09548.1.
CH471079 Genomic DNA. Translation: EAX09549.1.
BC009047 mRNA. Translation: AAH09047.1.
CCDSiCCDS13690.1. [O76083-1]
CCDS33567.1. [O76083-5]
CCDS33568.1. [O76083-2]
CCDS33569.1. [O76083-15]
CCDS33570.1. [O76083-12]
CCDS33571.1. [O76083-4]
CCDS42941.1. [O76083-8]
CCDS42942.1. [O76083-14]
CCDS42943.1. [O76083-6]
CCDS42944.1. [O76083-11]
CCDS42945.1. [O76083-13]
CCDS42946.1. [O76083-3]
CCDS42947.1. [O76083-9]
RefSeqiNP_001001567.1. NM_001001567.1. [O76083-2]
NP_001001568.1. NM_001001568.1. [O76083-3]
NP_001001569.1. NM_001001569.1. [O76083-4]
NP_001001570.1. NM_001001570.1. [O76083-5]
NP_001001571.1. NM_001001571.1. [O76083-6]
NP_001001572.1. NM_001001572.1. [O76083-7]
NP_001001573.1. NM_001001573.1. [O76083-7]
NP_001001574.1. NM_001001574.1. [O76083-8]
NP_001001575.1. NM_001001575.1. [O76083-9]
NP_001001576.1. NM_001001576.1. [O76083-10]
NP_001001577.1. NM_001001577.1. [O76083-11]
NP_001001578.1. NM_001001578.1. [O76083-12]
NP_001001579.1. NM_001001579.1. [O76083-7]
NP_001001580.1. NM_001001580.1. [O76083-10]
NP_001001581.1. NM_001001581.1. [O76083-13]
NP_001001582.1. NM_001001582.1. [O76083-14]
NP_001001583.1. NM_001001583.1. [O76083-15]
NP_001001584.1. NM_001001584.2. [O76083-7]
NP_001001585.1. NM_001001585.1. [O76083-7]
NP_002597.1. NM_002606.2. [O76083-1]
UniGeneiHs.473927.

Genome annotation databases

EnsembliENST00000291539; ENSP00000291539; ENSG00000160191. [O76083-1]
ENST00000328862; ENSP00000328699; ENSG00000160191. [O76083-15]
ENST00000335440; ENSP00000335365; ENSG00000160191. [O76083-12]
ENST00000335512; ENSP00000335242; ENSG00000160191. [O76083-2]
ENST00000349112; ENSP00000344730; ENSG00000160191. [O76083-4]
ENST00000380328; ENSP00000369685; ENSG00000160191. [O76083-5]
ENST00000398224; ENSP00000381280; ENSG00000160191. [O76083-3]
ENST00000398225; ENSP00000381281; ENSG00000160191. [O76083-14]
ENST00000398227; ENSP00000381283; ENSG00000160191. [O76083-9]
ENST00000398229; ENSP00000381285; ENSG00000160191. [O76083-11]
ENST00000398232; ENSP00000381287; ENSG00000160191. [O76083-13]
ENST00000398234; ENSP00000381289; ENSG00000160191. [O76083-6]
ENST00000398236; ENSP00000381291; ENSG00000160191. [O76083-8]
GeneIDi5152.
KEGGihsa:5152.
UCSCiuc002zbm.3. human. [O76083-1]
uc002zbn.3. human. [O76083-3]
uc002zbo.3. human. [O76083-5]
uc002zbq.3. human. [O76083-12]
uc002zbt.3. human. [O76083-4]
uc002zbu.3. human. [O76083-11]
uc002zbv.3. human. [O76083-9]
uc002zbw.3. human. [O76083-10]
uc002zbx.3. human. [O76083-2]
uc002zbz.3. human. [O76083-16]
uc002zca.3. human. [O76083-14]
uc002zcb.3. human. [O76083-15]
uc002zcc.3. human. [O76083-6]
uc002zcd.3. human. [O76083-8]
uc002zce.3. human. [O76083-13]
uc010gpf.1. human. [O76083-7]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF048837 mRNA. Translation: AAC39778.1 .
AB017602 Genomic DNA. Translation: BAA88847.1 .
AF067223 mRNA. Translation: AAC26723.1 .
AF067224 mRNA. Translation: AAC26724.1 .
AF067225 mRNA. Translation: AAC26725.1 .
AF067226 mRNA. Translation: AAC26726.1 .
AY196299 mRNA. Translation: AAO34685.1 .
AY196300 mRNA. Translation: AAO34686.1 .
AY196301 mRNA. Translation: AAO34687.1 .
AY196302 mRNA. Translation: AAO34688.1 .
AY196303 mRNA. Translation: AAO34689.1 .
AY196304 mRNA. Translation: AAO34690.1 .
AY196305 mRNA. Translation: AAO34691.1 .
AY196306 mRNA. Translation: AAO34692.1 .
AY196307 mRNA. Translation: AAO34693.1 .
AY196308 mRNA. Translation: AAO34694.1 .
AY196309 mRNA. Translation: AAO34695.1 .
AY196310 mRNA. Translation: AAO34696.1 .
AY196311 mRNA. Translation: AAO34697.1 .
AY196312 mRNA. Translation: AAO34698.1 .
AY196313 mRNA. Translation: AAO34699.1 .
AY196314 mRNA. Translation: AAO34700.1 .
AY242121 mRNA. Translation: AAO88210.1 .
AY701187 mRNA. Translation: AAV84271.1 .
AK294112 mRNA. Translation: BAG57446.1 .
AK314679 mRNA. Translation: BAG37232.1 .
BT007016 mRNA. Translation: AAP35662.1 .
AP001747 Genomic DNA. Translation: BAA95552.1 .
CH471079 Genomic DNA. Translation: EAX09544.1 .
CH471079 Genomic DNA. Translation: EAX09536.1 .
CH471079 Genomic DNA. Translation: EAX09537.1 .
CH471079 Genomic DNA. Translation: EAX09541.1 .
CH471079 Genomic DNA. Translation: EAX09542.1 .
CH471079 Genomic DNA. Translation: EAX09546.1 .
CH471079 Genomic DNA. Translation: EAX09540.1 .
CH471079 Genomic DNA. Translation: EAX09548.1 .
CH471079 Genomic DNA. Translation: EAX09549.1 .
BC009047 mRNA. Translation: AAH09047.1 .
CCDSi CCDS13690.1. [O76083-1 ]
CCDS33567.1. [O76083-5 ]
CCDS33568.1. [O76083-2 ]
CCDS33569.1. [O76083-15 ]
CCDS33570.1. [O76083-12 ]
CCDS33571.1. [O76083-4 ]
CCDS42941.1. [O76083-8 ]
CCDS42942.1. [O76083-14 ]
CCDS42943.1. [O76083-6 ]
CCDS42944.1. [O76083-11 ]
CCDS42945.1. [O76083-13 ]
CCDS42946.1. [O76083-3 ]
CCDS42947.1. [O76083-9 ]
RefSeqi NP_001001567.1. NM_001001567.1. [O76083-2 ]
NP_001001568.1. NM_001001568.1. [O76083-3 ]
NP_001001569.1. NM_001001569.1. [O76083-4 ]
NP_001001570.1. NM_001001570.1. [O76083-5 ]
NP_001001571.1. NM_001001571.1. [O76083-6 ]
NP_001001572.1. NM_001001572.1. [O76083-7 ]
NP_001001573.1. NM_001001573.1. [O76083-7 ]
NP_001001574.1. NM_001001574.1. [O76083-8 ]
NP_001001575.1. NM_001001575.1. [O76083-9 ]
NP_001001576.1. NM_001001576.1. [O76083-10 ]
NP_001001577.1. NM_001001577.1. [O76083-11 ]
NP_001001578.1. NM_001001578.1. [O76083-12 ]
NP_001001579.1. NM_001001579.1. [O76083-7 ]
NP_001001580.1. NM_001001580.1. [O76083-10 ]
NP_001001581.1. NM_001001581.1. [O76083-13 ]
NP_001001582.1. NM_001001582.1. [O76083-14 ]
NP_001001583.1. NM_001001583.1. [O76083-15 ]
NP_001001584.1. NM_001001584.2. [O76083-7 ]
NP_001001585.1. NM_001001585.1. [O76083-7 ]
NP_002597.1. NM_002606.2. [O76083-1 ]
UniGenei Hs.473927.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2HD1 X-ray 2.23 A/B 241-566 [» ]
2YY2 X-ray 2.80 A/B 241-566 [» ]
3DY8 X-ray 2.15 A/B 242-566 [» ]
3DYL X-ray 2.70 A/B 242-566 [» ]
3DYN X-ray 2.10 A/B 242-566 [» ]
3DYQ X-ray 2.50 A/B 242-566 [» ]
3DYS X-ray 2.30 A/B 242-566 [» ]
3JSI X-ray 2.72 A/B 242-566 [» ]
3JSW X-ray 2.30 A/B 242-566 [» ]
3K3E X-ray 2.70 A/B 241-566 [» ]
3K3H X-ray 2.50 A/B 241-566 [» ]
3N3Z X-ray 2.75 A/B 241-566 [» ]
3QI3 X-ray 2.30 A/B 1-593 [» ]
3QI4 X-ray 2.50 A/B 1-593 [» ]
4E90 X-ray 2.50 A/B 242-566 [» ]
4G2J X-ray 2.40 A/B 242-566 [» ]
4G2L X-ray 3.00 A/B 242-566 [» ]
4GH6 X-ray 2.70 A/B 241-566 [» ]
ProteinModelPortali O76083.
SMRi O76083. Positions 242-565.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111178. 4 interactions.
IntActi O76083. 2 interactions.
MINTi MINT-1444906.

Chemistry

BindingDBi O76083.
ChEMBLi CHEMBL2363066.
DrugBanki DB00201. Caffeine.
GuidetoPHARMACOLOGYi 1309.

PTM databases

PhosphoSitei O76083.

Proteomic databases

PaxDbi O76083.
PRIDEi O76083.

Protocols and materials databases

DNASUi 5152.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000291539 ; ENSP00000291539 ; ENSG00000160191 . [O76083-1 ]
ENST00000328862 ; ENSP00000328699 ; ENSG00000160191 . [O76083-15 ]
ENST00000335440 ; ENSP00000335365 ; ENSG00000160191 . [O76083-12 ]
ENST00000335512 ; ENSP00000335242 ; ENSG00000160191 . [O76083-2 ]
ENST00000349112 ; ENSP00000344730 ; ENSG00000160191 . [O76083-4 ]
ENST00000380328 ; ENSP00000369685 ; ENSG00000160191 . [O76083-5 ]
ENST00000398224 ; ENSP00000381280 ; ENSG00000160191 . [O76083-3 ]
ENST00000398225 ; ENSP00000381281 ; ENSG00000160191 . [O76083-14 ]
ENST00000398227 ; ENSP00000381283 ; ENSG00000160191 . [O76083-9 ]
ENST00000398229 ; ENSP00000381285 ; ENSG00000160191 . [O76083-11 ]
ENST00000398232 ; ENSP00000381287 ; ENSG00000160191 . [O76083-13 ]
ENST00000398234 ; ENSP00000381289 ; ENSG00000160191 . [O76083-6 ]
ENST00000398236 ; ENSP00000381291 ; ENSG00000160191 . [O76083-8 ]
GeneIDi 5152.
KEGGi hsa:5152.
UCSCi uc002zbm.3. human. [O76083-1 ]
uc002zbn.3. human. [O76083-3 ]
uc002zbo.3. human. [O76083-5 ]
uc002zbq.3. human. [O76083-12 ]
uc002zbt.3. human. [O76083-4 ]
uc002zbu.3. human. [O76083-11 ]
uc002zbv.3. human. [O76083-9 ]
uc002zbw.3. human. [O76083-10 ]
uc002zbx.3. human. [O76083-2 ]
uc002zbz.3. human. [O76083-16 ]
uc002zca.3. human. [O76083-14 ]
uc002zcb.3. human. [O76083-15 ]
uc002zcc.3. human. [O76083-6 ]
uc002zcd.3. human. [O76083-8 ]
uc002zce.3. human. [O76083-13 ]
uc010gpf.1. human. [O76083-7 ]

Organism-specific databases

CTDi 5152.
GeneCardsi GC21P044073.
HGNCi HGNC:8795. PDE9A.
HPAi HPA011380.
MIMi 602973. gene.
neXtProti NX_O76083.
PharmGKBi PA33143.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG268427.
GeneTreei ENSGT00760000118889.
HOVERGENi HBG053545.
KOi K13761.
OMAi PRAFKIN.
OrthoDBi EOG7DFXC4.
PhylomeDBi O76083.
TreeFami TF314638.

Enzyme and pathway databases

Reactomei REACT_23767. cGMP effects.

Miscellaneous databases

ChiTaRSi PDE9A. human.
EvolutionaryTracei O76083.
GeneWikii PDE9A.
GenomeRNAii 5152.
NextBioi 19884.
PROi O76083.
SOURCEi Search...

Gene expression databases

Bgeei O76083.
Genevestigatori O76083.

Family and domain databases

Gene3Di 1.10.1300.10. 1 hit.
InterProi IPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view ]
Pfami PF00233. PDEase_I. 1 hit.
[Graphical view ]
PRINTSi PR00387. PDIESTERASE1.
SMARTi SM00471. HDc. 1 hit.
[Graphical view ]
PROSITEi PS00126. PDEASE_I. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and characterization of PDE9A, a novel human cGMP-specific phosphodiesterase."
    Fisher D.A., Smith J.F., Pillar J.S., St Denis S.H., Cheng J.B.
    J. Biol. Chem. 273:15559-15564(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE9A1).
    Tissue: Brain, Prostate and Testis.
  2. "Identification and characterization of a novel cyclic nucleotide phosphodiesterase gene (PDE9A) that maps to 21q22.3: alternative splicing of mRNA transcripts, genomic structure and sequence."
    Guipponi M., Scott H.S., Kudoh J., Kawasaki K., Shibuya K., Shintani A., Asakawa S., Chen H., Lalioti M.D., Rossier C., Minoshima S., Shimizu N., Antonarakis S.E.
    Hum. Genet. 103:386-392(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS PDE9A1; PDE9A2; PDE9A3 AND PDE9A4).
    Tissue: Fetal brain.
  3. "Identification and distribution of different mRNA variants produced by differential splicing in the human phosphodiesterase 9A gene."
    Rentero C., Monfort A., Puigdomenech P.
    Biochem. Biophys. Res. Commun. 301:686-692(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PDE9A5; PDE9A6; PDE9A7; PDE9A9; PDE9A10; PDE9A11; PDE9A12; PDE9A13; PDE9A16; PDE9A17 AND PDE9A18), TISSUE SPECIFICITY.
  4. "Identification and characterization of a new human type 9 cGMP-specific phosphodiesterase splice variant (PDE9A5). Differential tissue distribution and subcellular localization of PDE9A variants."
    Wang P., Wu P., Egan R.W., Billah M.M.
    Gene 314:15-27(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE9A6).
    Tissue: Brain, Small intestine and Spleen.
  5. "Specific use of start codons and cellular localization of splice variants of human phosphodiesterase 9A gene."
    Rentero C., Puigdomenech P.
    BMC Mol. Biol. 7:39-39(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE9A21), SUBCELLULAR LOCATION.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS PDE9A1 AND PDE9A3).
  7. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE9A2).
  8. "The DNA sequence of human chromosome 21."
    Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A.
    , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.
    Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE9A2).
    Tissue: Eye.
  11. "Crystal structure of phosphodiesterase 9 shows orientation variation of inhibitor 3-isobutyl-1-methylxanthine binding."
    Huai Q., Wang H., Zhang W., Colman R.W., Robinson H., Ke H.
    Proc. Natl. Acad. Sci. U.S.A. 101:9624-9629(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.23 ANGSTROMS) OF 241-566 IN COMPLEX WITH THE INHIBITOR IBMX.
  12. Cited for: X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 242-566 IN COMPLEX WITH MAGNESIUM; MANGANESE; ZINC; GMP AND CGMP, FUNCTION, COFACTOR, MUTAGENESIS OF HIS-312 AND HIS-356.
  13. "Crystal structure of the human phosphodiesterase 9a catalytic domain."
    RIKEN structural genomics initiative (RSGI)
    Submitted (FEB-2009) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (2.80 ANGSTROMS) OF 241-566.

Entry informationi

Entry nameiPDE9A_HUMAN
AccessioniPrimary (citable) accession number: O76083
Secondary accession number(s): B2RBI5
, B4DFI5, D3DSJ8, D3DSJ9, O75490, O75491, O95225, Q53Y40, Q5QD39, Q86SF7, Q86SI6, Q86SJ3, Q86WN3, Q86WN4, Q86WN5, Q86WN6, Q86WN7, Q86WN8, Q86WN9, Q86WP0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: October 29, 2014
This is version 138 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3