Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O76083

- PDE9A_HUMAN

UniProt

O76083 - PDE9A_HUMAN

Protein

High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

Gene

PDE9A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 137 (01 Oct 2014)
      Sequence version 1 (01 Nov 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Hydrolyzes the second messenger cGMP, which is a key regulator of many important physiological processes.1 Publication

    Catalytic activityi

    Guanosine 3',5'-cyclic phosphate + H2O = guanosine 5'-phosphate.

    Cofactori

    Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.1 Publication

    Enzyme regulationi

    Inhibited by zaprinast.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei312 – 3121Proton donor
    Metal bindingi316 – 3161Divalent metal cation 1
    Metal bindingi352 – 3521Divalent metal cation 1
    Metal bindingi353 – 3531Divalent metal cation 1
    Metal bindingi353 – 3531Divalent metal cation 2
    Binding sitei353 – 3531cGMP1 Publication
    Metal bindingi462 – 4621Divalent metal cation 1
    Binding sitei462 – 4621cGMP1 Publication
    Binding sitei484 – 4841cGMP1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi312 – 3165cGMP1 Publication
    Nucleotide bindingi512 – 5132cGMP1 Publication

    GO - Molecular functioni

    1. 3',5'-cyclic-GMP phosphodiesterase activity Source: UniProtKB-EC
    2. 3',5'-cyclic-nucleotide phosphodiesterase activity Source: ProtInc
    3. metal ion binding Source: UniProtKB-KW
    4. protein binding Source: IntAct

    GO - Biological processi

    1. blood coagulation Source: Reactome
    2. cGMP-mediated signaling Source: Ensembl
    3. metabolic process Source: GOC
    4. signal transduction Source: ProtInc

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    cGMP, Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_23767. cGMP effects.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A (EC:3.1.4.35)
    Gene namesi
    Name:PDE9A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 21

    Organism-specific databases

    HGNCiHGNC:8795. PDE9A.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: UniProtKB
    2. endoplasmic reticulum Source: UniProtKB-SubCell
    3. Golgi apparatus Source: UniProtKB-SubCell
    4. perikaryon Source: Ensembl
    5. perinuclear region of cytoplasm Source: UniProtKB-SubCell
    6. ruffle membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Cytoplasm, Endoplasmic reticulum, Golgi apparatus, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi312 – 3121H → A: Completely abolishes catalytic activity. 1 Publication
    Mutagenesisi356 – 3561H → A: Reduces catalytic activity, but has no effect on substrate affinity. 1 Publication

    Organism-specific databases

    PharmGKBiPA33143.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 593593High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9APRO_0000198841Add
    BLAST

    Proteomic databases

    PaxDbiO76083.
    PRIDEiO76083.

    PTM databases

    PhosphoSiteiO76083.

    Expressioni

    Tissue specificityi

    Expressed in all tissues examined (testis, brain, small intestine, skeletal muscle, heart, lung, thymus, spleen, placenta, kidney, liver, pancreas, ovary and prostate) except blood. Highest levels in brain, heart, kidney, spleen, prostate and colon. Isoform PDE9A12 is found in prostate.1 Publication

    Gene expression databases

    ArrayExpressiO76083.
    BgeeiO76083.
    GenevestigatoriO76083.

    Organism-specific databases

    HPAiHPA011380.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    TRIM32Q130493EBI-742764,EBI-742790

    Protein-protein interaction databases

    BioGridi111178. 3 interactions.
    IntActiO76083. 2 interactions.
    MINTiMINT-1444906.

    Structurei

    Secondary structure

    1
    593
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi250 – 2556
    Helixi263 – 2653
    Helixi268 – 28114
    Helixi284 – 2885
    Helixi292 – 30514
    Beta strandi310 – 3134
    Helixi314 – 33017
    Helixi333 – 3364
    Helixi339 – 35113
    Turni352 – 3554
    Helixi361 – 3677
    Helixi370 – 3756
    Helixi380 – 39314
    Helixi396 – 3983
    Turni400 – 4034
    Helixi406 – 42217
    Helixi425 – 4273
    Helixi428 – 43912
    Helixi447 – 46216
    Helixi465 – 4673
    Helixi470 – 49425
    Helixi500 – 5023
    Turni504 – 5063
    Helixi509 – 51911
    Helixi521 – 53111
    Helixi535 – 56127
    Beta strandi562 – 5643

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2HD1X-ray2.23A/B241-566[»]
    2YY2X-ray2.80A/B241-566[»]
    3DY8X-ray2.15A/B242-566[»]
    3DYLX-ray2.70A/B242-566[»]
    3DYNX-ray2.10A/B242-566[»]
    3DYQX-ray2.50A/B242-566[»]
    3DYSX-ray2.30A/B242-566[»]
    3JSIX-ray2.72A/B242-566[»]
    3JSWX-ray2.30A/B242-566[»]
    3K3EX-ray2.70A/B241-566[»]
    3K3HX-ray2.50A/B241-566[»]
    3N3ZX-ray2.75A/B241-566[»]
    3QI3X-ray2.30A/B1-593[»]
    3QI4X-ray2.50A/B1-593[»]
    4E90X-ray2.50A/B242-566[»]
    4G2JX-ray2.40A/B242-566[»]
    4G2LX-ray3.00A/B242-566[»]
    4GH6X-ray2.70A/B241-566[»]
    ProteinModelPortaliO76083.
    SMRiO76083. Positions 242-565.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO76083.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni288 – 550263CatalyticBy similarityAdd
    BLAST

    Domaini

    Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG268427.
    HOVERGENiHBG053545.
    InParanoidiO76083.
    KOiK13761.
    OMAiPRAFKIN.
    OrthoDBiEOG7DFXC4.
    PhylomeDBiO76083.
    TreeFamiTF314638.

    Family and domain databases

    Gene3Di1.10.1300.10. 1 hit.
    InterProiIPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    [Graphical view]
    PfamiPF00233. PDEase_I. 1 hit.
    [Graphical view]
    PRINTSiPR00387. PDIESTERASE1.
    SMARTiSM00471. HDc. 1 hit.
    [Graphical view]
    PROSITEiPS00126. PDEASE_I. 1 hit.
    [Graphical view]

    Sequences (16)i

    Sequence statusi: Complete.

    This entry describes 16 isoformsi produced by alternative splicing. Align

    Isoform PDE9A1 (identifier: O76083-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGSGSSSYRP KAIYLDIDGR IQKVIFSKYC NSSDIMDLFC IATGLPRNTT    50
    ISLLTTDDAM VSIDPTMPAN SERTPYKVRP VAIKQLSAGV EDKRTTSRGQ 100
    SAERPLRDRR VVGLEQPRRE GAFESGQVEP RPREPQGCYQ EGQRIPPERE 150
    ELIQSVLAQV AEQFSRAFKI NELKAEVANH LAVLEKRVEL EGLKVVEIEK 200
    CKSDIKKMRE ELAARSSRTN CPCKYSFLDN HKKLTPRRDV PTYPKYLLSP 250
    ETIEALRKPT FDVWLWEPNE MLSCLEHMYH DLGLVRDFSI NPVTLRRWLF 300
    CVHDNYRNNP FHNFRHCFCV AQMMYSMVWL CSLQEKFSQT DILILMTAAI 350
    CHDLDHPGYN NTYQINARTE LAVRYNDISP LENHHCAVAF QILAEPECNI 400
    FSNIPPDGFK QIRQGMITLI LATDMARHAE IMDSFKEKME NFDYSNEEHM 450
    TLLKMILIKC CDISNEVRPM EVAEPWVDCL LEEYFMQSDR EKSEGLPVAP 500
    FMDRDKVTKA TAQIGFIKFV LIPMFETVTK LFPMVEEIML QPLWESRDRY 550
    EELKRIDDAM KELQKKTDSL TSGATEKSRE RSRDVKNSEG DCA 593
    Length:593
    Mass (Da):68,493
    Last modified:November 1, 1998 - v1
    Checksum:iE2731C7C828C0994
    GO
    Isoform PDE9A2 (identifier: O76083-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         88-147: Missing.

    Show »
    Length:533
    Mass (Da):61,709
    Checksum:i728ADAAACE0E4D29
    GO
    Isoform PDE9A3 (identifier: O76083-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-73: MGSGSSSYRP...DPTMPANSER → MDAFRS
         88-147: Missing.

    Show »
    Length:466
    Mass (Da):54,440
    Checksum:iDE087DD09AAF4794
    GO
    Isoform PDE9A4 (identifier: O76083-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         24-165: VIFSKYCNSS...VLAQVAEQFS → HSVQSETCGHQATL

    Show »
    Length:465
    Mass (Da):54,096
    Checksum:iBDD6A8F85E591A67
    GO
    Isoform PDE9A5 (identifier: O76083-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         74-165: TPYKVRPVAI...VLAQVAEQFS → NELILYTSLR...SETCGHQATL

    Show »
    Length:540
    Mass (Da):62,491
    Checksum:i612A2ECEE7F656B4
    GO
    Isoform PDE9A6 (identifier: O76083-6) [UniParc]FASTAAdd to Basket

    Also known as: PDE9A5

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR
         88-147: Missing.

    Show »
    Length:492
    Mass (Da):57,285
    Checksum:i1FE4F709AD50C0E6
    GO
    Isoform PDE9A7 (identifier: O76083-7) [UniParc]FASTAAdd to Basket

    Also known as: PDE9A8, PDE9A14, PDE9A19, PDE9A20

    The sequence of this isoform differs from the canonical sequence as follows:
         1-207: Missing.

    Show »
    Length:386
    Mass (Da):45,290
    Checksum:i4120AB778B9746B9
    GO
    Isoform PDE9A9 (identifier: O76083-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         48-73: Missing.
         88-147: Missing.

    Show »
    Length:507
    Mass (Da):58,933
    Checksum:iE211E0EB8B67F284
    GO
    Isoform PDE9A10 (identifier: O76083-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-160: Missing.
         161-165: AEQFS → MDAFR

    Show »
    Length:433
    Mass (Da):50,713
    Checksum:iD6036BB3CA9FB7B2
    GO
    Isoform PDE9A11 (identifier: O76083-10) [UniParc]FASTAAdd to Basket

    Also known as: PDE9A15

    The sequence of this isoform differs from the canonical sequence as follows:
         1-217: Missing.
         218-218: R → M

    Show »
    Length:376
    Mass (Da):44,134
    Checksum:iBF896546AED87831
    GO
    Isoform PDE9A12 (identifier: O76083-11) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR
         73-165: Missing.

    Show »
    Length:459
    Mass (Da):53,489
    Checksum:iE7DA06012931A850
    GO
    Isoform PDE9A13 (identifier: O76083-12) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         24-165: VIFSKYCNSS...VLAQVAEQFS → EHDHLPADHR...SETCGHQATL

    Show »
    Length:491
    Mass (Da):57,350
    Checksum:iCA53A1793F405CDB
    GO
    Isoform PDE9A16 (identifier: O76083-13) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-73: MGSGSSSYRP...DPTMPANSER → MDAFRS

    Show »
    Length:526
    Mass (Da):61,223
    Checksum:i02A36AE5185CEDF3
    GO
    Isoform PDE9A17 (identifier: O76083-14) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR

    Show »
    Length:552
    Mass (Da):64,068
    Checksum:iF10D41FE319A6D28
    GO
    Isoform PDE9A18 (identifier: O76083-15) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         48-73: Missing.

    Show »
    Length:567
    Mass (Da):65,717
    Checksum:i2DFEB16AFCA94F0D
    GO
    Isoform PDE9A21 (identifier: O76083-16) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-73: MGSGSSSYRP...DPTMPANSER → MSSFSIHHSVTCCFYLVRSHGRPTS
         88-147: Missing.

    Show »
    Length:485
    Mass (Da):56,554
    Checksum:i82275A46E46C4D83
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti79 – 791R → G in BAG57446. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 217217Missing in isoform PDE9A11. 1 PublicationVSP_017302Add
    BLAST
    Alternative sequencei1 – 207207Missing in isoform PDE9A7. 1 PublicationVSP_017303Add
    BLAST
    Alternative sequencei1 – 160160Missing in isoform PDE9A10. 1 PublicationVSP_017304Add
    BLAST
    Alternative sequencei1 – 7373MGSGS…ANSER → MSSFSIHHSVTCCFYLVRSH GRPTS in isoform PDE9A21. 1 PublicationVSP_038647Add
    BLAST
    Alternative sequencei1 – 7373MGSGS…ANSER → MDAFRS in isoform PDE9A3 and isoform PDE9A16. 3 PublicationsVSP_004598Add
    BLAST
    Alternative sequencei1 – 4646MGSGS…ATGLP → MDAFR in isoform PDE9A6, isoform PDE9A12 and isoform PDE9A17. 2 PublicationsVSP_017305Add
    BLAST
    Alternative sequencei24 – 165142VIFSK…AEQFS → EHDHLPADHRRRHGLHRPHH AREFRTHSVQSETCGHQATL in isoform PDE9A13. 1 PublicationVSP_017306Add
    BLAST
    Alternative sequencei24 – 165142VIFSK…AEQFS → HSVQSETCGHQATL in isoform PDE9A4. 1 PublicationVSP_004600Add
    BLAST
    Alternative sequencei48 – 7326Missing in isoform PDE9A9 and isoform PDE9A18. 1 PublicationVSP_017307Add
    BLAST
    Alternative sequencei73 – 16593Missing in isoform PDE9A12. 1 PublicationVSP_017308Add
    BLAST
    Alternative sequencei74 – 16592TPYKV…AEQFS → NELILYTSLRNLLFLPSKES WASHQHSVQSETCGHQATL in isoform PDE9A5. 1 PublicationVSP_017309Add
    BLAST
    Alternative sequencei88 – 14760Missing in isoform PDE9A2, isoform PDE9A3, isoform PDE9A6, isoform PDE9A9 and isoform PDE9A21. 7 PublicationsVSP_004599Add
    BLAST
    Alternative sequencei161 – 1655AEQFS → MDAFR in isoform PDE9A10. 1 PublicationVSP_017310
    Alternative sequencei218 – 2181R → M in isoform PDE9A11. 1 PublicationVSP_017311

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF048837 mRNA. Translation: AAC39778.1.
    AB017602 Genomic DNA. Translation: BAA88847.1.
    AF067223 mRNA. Translation: AAC26723.1.
    AF067224 mRNA. Translation: AAC26724.1.
    AF067225 mRNA. Translation: AAC26725.1.
    AF067226 mRNA. Translation: AAC26726.1.
    AY196299 mRNA. Translation: AAO34685.1.
    AY196300 mRNA. Translation: AAO34686.1.
    AY196301 mRNA. Translation: AAO34687.1.
    AY196302 mRNA. Translation: AAO34688.1.
    AY196303 mRNA. Translation: AAO34689.1.
    AY196304 mRNA. Translation: AAO34690.1.
    AY196305 mRNA. Translation: AAO34691.1.
    AY196306 mRNA. Translation: AAO34692.1.
    AY196307 mRNA. Translation: AAO34693.1.
    AY196308 mRNA. Translation: AAO34694.1.
    AY196309 mRNA. Translation: AAO34695.1.
    AY196310 mRNA. Translation: AAO34696.1.
    AY196311 mRNA. Translation: AAO34697.1.
    AY196312 mRNA. Translation: AAO34698.1.
    AY196313 mRNA. Translation: AAO34699.1.
    AY196314 mRNA. Translation: AAO34700.1.
    AY242121 mRNA. Translation: AAO88210.1.
    AY701187 mRNA. Translation: AAV84271.1.
    AK294112 mRNA. Translation: BAG57446.1.
    AK314679 mRNA. Translation: BAG37232.1.
    BT007016 mRNA. Translation: AAP35662.1.
    AP001747 Genomic DNA. Translation: BAA95552.1.
    CH471079 Genomic DNA. Translation: EAX09544.1.
    CH471079 Genomic DNA. Translation: EAX09536.1.
    CH471079 Genomic DNA. Translation: EAX09537.1.
    CH471079 Genomic DNA. Translation: EAX09541.1.
    CH471079 Genomic DNA. Translation: EAX09542.1.
    CH471079 Genomic DNA. Translation: EAX09546.1.
    CH471079 Genomic DNA. Translation: EAX09540.1.
    CH471079 Genomic DNA. Translation: EAX09548.1.
    CH471079 Genomic DNA. Translation: EAX09549.1.
    BC009047 mRNA. Translation: AAH09047.1.
    CCDSiCCDS13690.1. [O76083-1]
    CCDS33567.1. [O76083-5]
    CCDS33568.1. [O76083-2]
    CCDS33569.1. [O76083-15]
    CCDS33570.1. [O76083-12]
    CCDS33571.1. [O76083-4]
    CCDS42941.1. [O76083-8]
    CCDS42942.1. [O76083-14]
    CCDS42943.1. [O76083-6]
    CCDS42944.1. [O76083-11]
    CCDS42945.1. [O76083-13]
    CCDS42946.1. [O76083-3]
    CCDS42947.1. [O76083-9]
    RefSeqiNP_001001567.1. NM_001001567.1. [O76083-2]
    NP_001001568.1. NM_001001568.1. [O76083-3]
    NP_001001569.1. NM_001001569.1. [O76083-4]
    NP_001001570.1. NM_001001570.1. [O76083-5]
    NP_001001571.1. NM_001001571.1. [O76083-6]
    NP_001001572.1. NM_001001572.1. [O76083-7]
    NP_001001573.1. NM_001001573.1. [O76083-7]
    NP_001001574.1. NM_001001574.1. [O76083-8]
    NP_001001575.1. NM_001001575.1. [O76083-9]
    NP_001001576.1. NM_001001576.1. [O76083-10]
    NP_001001577.1. NM_001001577.1. [O76083-11]
    NP_001001578.1. NM_001001578.1. [O76083-12]
    NP_001001579.1. NM_001001579.1. [O76083-7]
    NP_001001580.1. NM_001001580.1. [O76083-10]
    NP_001001581.1. NM_001001581.1. [O76083-13]
    NP_001001582.1. NM_001001582.1. [O76083-14]
    NP_001001583.1. NM_001001583.1. [O76083-15]
    NP_001001584.1. NM_001001584.2. [O76083-7]
    NP_001001585.1. NM_001001585.1. [O76083-7]
    NP_002597.1. NM_002606.2. [O76083-1]
    UniGeneiHs.473927.

    Genome annotation databases

    EnsembliENST00000291539; ENSP00000291539; ENSG00000160191. [O76083-1]
    ENST00000328862; ENSP00000328699; ENSG00000160191. [O76083-15]
    ENST00000335440; ENSP00000335365; ENSG00000160191. [O76083-12]
    ENST00000335512; ENSP00000335242; ENSG00000160191. [O76083-2]
    ENST00000349112; ENSP00000344730; ENSG00000160191. [O76083-4]
    ENST00000380328; ENSP00000369685; ENSG00000160191. [O76083-5]
    ENST00000398224; ENSP00000381280; ENSG00000160191. [O76083-3]
    ENST00000398225; ENSP00000381281; ENSG00000160191. [O76083-14]
    ENST00000398227; ENSP00000381283; ENSG00000160191. [O76083-9]
    ENST00000398229; ENSP00000381285; ENSG00000160191. [O76083-11]
    ENST00000398232; ENSP00000381287; ENSG00000160191. [O76083-13]
    ENST00000398234; ENSP00000381289; ENSG00000160191. [O76083-6]
    ENST00000398236; ENSP00000381291; ENSG00000160191. [O76083-8]
    GeneIDi5152.
    KEGGihsa:5152.
    UCSCiuc002zbm.3. human. [O76083-1]
    uc002zbn.3. human. [O76083-3]
    uc002zbo.3. human. [O76083-5]
    uc002zbq.3. human. [O76083-12]
    uc002zbt.3. human. [O76083-4]
    uc002zbu.3. human. [O76083-11]
    uc002zbv.3. human. [O76083-9]
    uc002zbw.3. human. [O76083-10]
    uc002zbx.3. human. [O76083-2]
    uc002zbz.3. human. [O76083-16]
    uc002zca.3. human. [O76083-14]
    uc002zcb.3. human. [O76083-15]
    uc002zcc.3. human. [O76083-6]
    uc002zcd.3. human. [O76083-8]
    uc002zce.3. human. [O76083-13]
    uc010gpf.1. human. [O76083-7]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF048837 mRNA. Translation: AAC39778.1 .
    AB017602 Genomic DNA. Translation: BAA88847.1 .
    AF067223 mRNA. Translation: AAC26723.1 .
    AF067224 mRNA. Translation: AAC26724.1 .
    AF067225 mRNA. Translation: AAC26725.1 .
    AF067226 mRNA. Translation: AAC26726.1 .
    AY196299 mRNA. Translation: AAO34685.1 .
    AY196300 mRNA. Translation: AAO34686.1 .
    AY196301 mRNA. Translation: AAO34687.1 .
    AY196302 mRNA. Translation: AAO34688.1 .
    AY196303 mRNA. Translation: AAO34689.1 .
    AY196304 mRNA. Translation: AAO34690.1 .
    AY196305 mRNA. Translation: AAO34691.1 .
    AY196306 mRNA. Translation: AAO34692.1 .
    AY196307 mRNA. Translation: AAO34693.1 .
    AY196308 mRNA. Translation: AAO34694.1 .
    AY196309 mRNA. Translation: AAO34695.1 .
    AY196310 mRNA. Translation: AAO34696.1 .
    AY196311 mRNA. Translation: AAO34697.1 .
    AY196312 mRNA. Translation: AAO34698.1 .
    AY196313 mRNA. Translation: AAO34699.1 .
    AY196314 mRNA. Translation: AAO34700.1 .
    AY242121 mRNA. Translation: AAO88210.1 .
    AY701187 mRNA. Translation: AAV84271.1 .
    AK294112 mRNA. Translation: BAG57446.1 .
    AK314679 mRNA. Translation: BAG37232.1 .
    BT007016 mRNA. Translation: AAP35662.1 .
    AP001747 Genomic DNA. Translation: BAA95552.1 .
    CH471079 Genomic DNA. Translation: EAX09544.1 .
    CH471079 Genomic DNA. Translation: EAX09536.1 .
    CH471079 Genomic DNA. Translation: EAX09537.1 .
    CH471079 Genomic DNA. Translation: EAX09541.1 .
    CH471079 Genomic DNA. Translation: EAX09542.1 .
    CH471079 Genomic DNA. Translation: EAX09546.1 .
    CH471079 Genomic DNA. Translation: EAX09540.1 .
    CH471079 Genomic DNA. Translation: EAX09548.1 .
    CH471079 Genomic DNA. Translation: EAX09549.1 .
    BC009047 mRNA. Translation: AAH09047.1 .
    CCDSi CCDS13690.1. [O76083-1 ]
    CCDS33567.1. [O76083-5 ]
    CCDS33568.1. [O76083-2 ]
    CCDS33569.1. [O76083-15 ]
    CCDS33570.1. [O76083-12 ]
    CCDS33571.1. [O76083-4 ]
    CCDS42941.1. [O76083-8 ]
    CCDS42942.1. [O76083-14 ]
    CCDS42943.1. [O76083-6 ]
    CCDS42944.1. [O76083-11 ]
    CCDS42945.1. [O76083-13 ]
    CCDS42946.1. [O76083-3 ]
    CCDS42947.1. [O76083-9 ]
    RefSeqi NP_001001567.1. NM_001001567.1. [O76083-2 ]
    NP_001001568.1. NM_001001568.1. [O76083-3 ]
    NP_001001569.1. NM_001001569.1. [O76083-4 ]
    NP_001001570.1. NM_001001570.1. [O76083-5 ]
    NP_001001571.1. NM_001001571.1. [O76083-6 ]
    NP_001001572.1. NM_001001572.1. [O76083-7 ]
    NP_001001573.1. NM_001001573.1. [O76083-7 ]
    NP_001001574.1. NM_001001574.1. [O76083-8 ]
    NP_001001575.1. NM_001001575.1. [O76083-9 ]
    NP_001001576.1. NM_001001576.1. [O76083-10 ]
    NP_001001577.1. NM_001001577.1. [O76083-11 ]
    NP_001001578.1. NM_001001578.1. [O76083-12 ]
    NP_001001579.1. NM_001001579.1. [O76083-7 ]
    NP_001001580.1. NM_001001580.1. [O76083-10 ]
    NP_001001581.1. NM_001001581.1. [O76083-13 ]
    NP_001001582.1. NM_001001582.1. [O76083-14 ]
    NP_001001583.1. NM_001001583.1. [O76083-15 ]
    NP_001001584.1. NM_001001584.2. [O76083-7 ]
    NP_001001585.1. NM_001001585.1. [O76083-7 ]
    NP_002597.1. NM_002606.2. [O76083-1 ]
    UniGenei Hs.473927.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2HD1 X-ray 2.23 A/B 241-566 [» ]
    2YY2 X-ray 2.80 A/B 241-566 [» ]
    3DY8 X-ray 2.15 A/B 242-566 [» ]
    3DYL X-ray 2.70 A/B 242-566 [» ]
    3DYN X-ray 2.10 A/B 242-566 [» ]
    3DYQ X-ray 2.50 A/B 242-566 [» ]
    3DYS X-ray 2.30 A/B 242-566 [» ]
    3JSI X-ray 2.72 A/B 242-566 [» ]
    3JSW X-ray 2.30 A/B 242-566 [» ]
    3K3E X-ray 2.70 A/B 241-566 [» ]
    3K3H X-ray 2.50 A/B 241-566 [» ]
    3N3Z X-ray 2.75 A/B 241-566 [» ]
    3QI3 X-ray 2.30 A/B 1-593 [» ]
    3QI4 X-ray 2.50 A/B 1-593 [» ]
    4E90 X-ray 2.50 A/B 242-566 [» ]
    4G2J X-ray 2.40 A/B 242-566 [» ]
    4G2L X-ray 3.00 A/B 242-566 [» ]
    4GH6 X-ray 2.70 A/B 241-566 [» ]
    ProteinModelPortali O76083.
    SMRi O76083. Positions 242-565.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111178. 3 interactions.
    IntActi O76083. 2 interactions.
    MINTi MINT-1444906.

    Chemistry

    BindingDBi O76083.
    ChEMBLi CHEMBL2363066.
    GuidetoPHARMACOLOGYi 1309.

    PTM databases

    PhosphoSitei O76083.

    Proteomic databases

    PaxDbi O76083.
    PRIDEi O76083.

    Protocols and materials databases

    DNASUi 5152.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000291539 ; ENSP00000291539 ; ENSG00000160191 . [O76083-1 ]
    ENST00000328862 ; ENSP00000328699 ; ENSG00000160191 . [O76083-15 ]
    ENST00000335440 ; ENSP00000335365 ; ENSG00000160191 . [O76083-12 ]
    ENST00000335512 ; ENSP00000335242 ; ENSG00000160191 . [O76083-2 ]
    ENST00000349112 ; ENSP00000344730 ; ENSG00000160191 . [O76083-4 ]
    ENST00000380328 ; ENSP00000369685 ; ENSG00000160191 . [O76083-5 ]
    ENST00000398224 ; ENSP00000381280 ; ENSG00000160191 . [O76083-3 ]
    ENST00000398225 ; ENSP00000381281 ; ENSG00000160191 . [O76083-14 ]
    ENST00000398227 ; ENSP00000381283 ; ENSG00000160191 . [O76083-9 ]
    ENST00000398229 ; ENSP00000381285 ; ENSG00000160191 . [O76083-11 ]
    ENST00000398232 ; ENSP00000381287 ; ENSG00000160191 . [O76083-13 ]
    ENST00000398234 ; ENSP00000381289 ; ENSG00000160191 . [O76083-6 ]
    ENST00000398236 ; ENSP00000381291 ; ENSG00000160191 . [O76083-8 ]
    GeneIDi 5152.
    KEGGi hsa:5152.
    UCSCi uc002zbm.3. human. [O76083-1 ]
    uc002zbn.3. human. [O76083-3 ]
    uc002zbo.3. human. [O76083-5 ]
    uc002zbq.3. human. [O76083-12 ]
    uc002zbt.3. human. [O76083-4 ]
    uc002zbu.3. human. [O76083-11 ]
    uc002zbv.3. human. [O76083-9 ]
    uc002zbw.3. human. [O76083-10 ]
    uc002zbx.3. human. [O76083-2 ]
    uc002zbz.3. human. [O76083-16 ]
    uc002zca.3. human. [O76083-14 ]
    uc002zcb.3. human. [O76083-15 ]
    uc002zcc.3. human. [O76083-6 ]
    uc002zcd.3. human. [O76083-8 ]
    uc002zce.3. human. [O76083-13 ]
    uc010gpf.1. human. [O76083-7 ]

    Organism-specific databases

    CTDi 5152.
    GeneCardsi GC21P044073.
    HGNCi HGNC:8795. PDE9A.
    HPAi HPA011380.
    MIMi 602973. gene.
    neXtProti NX_O76083.
    PharmGKBi PA33143.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG268427.
    HOVERGENi HBG053545.
    InParanoidi O76083.
    KOi K13761.
    OMAi PRAFKIN.
    OrthoDBi EOG7DFXC4.
    PhylomeDBi O76083.
    TreeFami TF314638.

    Enzyme and pathway databases

    Reactomei REACT_23767. cGMP effects.

    Miscellaneous databases

    ChiTaRSi PDE9A. human.
    EvolutionaryTracei O76083.
    GeneWikii PDE9A.
    GenomeRNAii 5152.
    NextBioi 19884.
    PROi O76083.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O76083.
    Bgeei O76083.
    Genevestigatori O76083.

    Family and domain databases

    Gene3Di 1.10.1300.10. 1 hit.
    InterProi IPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    [Graphical view ]
    Pfami PF00233. PDEase_I. 1 hit.
    [Graphical view ]
    PRINTSi PR00387. PDIESTERASE1.
    SMARTi SM00471. HDc. 1 hit.
    [Graphical view ]
    PROSITEi PS00126. PDEASE_I. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and characterization of PDE9A, a novel human cGMP-specific phosphodiesterase."
      Fisher D.A., Smith J.F., Pillar J.S., St Denis S.H., Cheng J.B.
      J. Biol. Chem. 273:15559-15564(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE9A1).
      Tissue: Brain, Prostate and Testis.
    2. "Identification and characterization of a novel cyclic nucleotide phosphodiesterase gene (PDE9A) that maps to 21q22.3: alternative splicing of mRNA transcripts, genomic structure and sequence."
      Guipponi M., Scott H.S., Kudoh J., Kawasaki K., Shibuya K., Shintani A., Asakawa S., Chen H., Lalioti M.D., Rossier C., Minoshima S., Shimizu N., Antonarakis S.E.
      Hum. Genet. 103:386-392(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS PDE9A1; PDE9A2; PDE9A3 AND PDE9A4).
      Tissue: Fetal brain.
    3. "Identification and distribution of different mRNA variants produced by differential splicing in the human phosphodiesterase 9A gene."
      Rentero C., Monfort A., Puigdomenech P.
      Biochem. Biophys. Res. Commun. 301:686-692(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PDE9A5; PDE9A6; PDE9A7; PDE9A9; PDE9A10; PDE9A11; PDE9A12; PDE9A13; PDE9A16; PDE9A17 AND PDE9A18), TISSUE SPECIFICITY.
    4. "Identification and characterization of a new human type 9 cGMP-specific phosphodiesterase splice variant (PDE9A5). Differential tissue distribution and subcellular localization of PDE9A variants."
      Wang P., Wu P., Egan R.W., Billah M.M.
      Gene 314:15-27(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE9A6).
      Tissue: Brain, Small intestine and Spleen.
    5. "Specific use of start codons and cellular localization of splice variants of human phosphodiesterase 9A gene."
      Rentero C., Puigdomenech P.
      BMC Mol. Biol. 7:39-39(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE9A21), SUBCELLULAR LOCATION.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS PDE9A1 AND PDE9A3).
    7. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE9A2).
    8. "The DNA sequence of human chromosome 21."
      Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A.
      , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.
      Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE9A2).
      Tissue: Eye.
    11. "Crystal structure of phosphodiesterase 9 shows orientation variation of inhibitor 3-isobutyl-1-methylxanthine binding."
      Huai Q., Wang H., Zhang W., Colman R.W., Robinson H., Ke H.
      Proc. Natl. Acad. Sci. U.S.A. 101:9624-9629(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.23 ANGSTROMS) OF 241-566 IN COMPLEX WITH THE INHIBITOR IBMX.
    12. Cited for: X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 242-566 IN COMPLEX WITH MAGNESIUM; MANGANESE; ZINC; GMP AND CGMP, FUNCTION, COFACTOR, MUTAGENESIS OF HIS-312 AND HIS-356.
    13. "Crystal structure of the human phosphodiesterase 9a catalytic domain."
      RIKEN structural genomics initiative (RSGI)
      Submitted (FEB-2009) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (2.80 ANGSTROMS) OF 241-566.

    Entry informationi

    Entry nameiPDE9A_HUMAN
    AccessioniPrimary (citable) accession number: O76083
    Secondary accession number(s): B2RBI5
    , B4DFI5, D3DSJ8, D3DSJ9, O75490, O75491, O95225, Q53Y40, Q5QD39, Q86SF7, Q86SI6, Q86SJ3, Q86WN3, Q86WN4, Q86WN5, Q86WN6, Q86WN7, Q86WN8, Q86WN9, Q86WP0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: November 1, 1998
    Last modified: October 1, 2014
    This is version 137 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 21
      Human chromosome 21: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3