O76083 (PDE9A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A EC=3.1.4.35 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 593 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Hydrolyzes the second messenger cGMP, which is a key regulator of many important physiological processes. Ref.12 |
| Catalytic activity | Guanosine 3',5'-cyclic phosphate + H2O = guanosine 5'-phosphate. |
| Cofactor | Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions. Ref.12 |
| Enzyme regulation | Inhibited by zaprinast. |
| Subcellular location | Isoform PDE9A1: Cell projection › ruffle membrane. Cytoplasm › perinuclear region Ref.5. Golgi apparatus. Endoplasmic reticulum Ref.5. Isoform PDE9A2: Cell projection › ruffle membrane. Cytoplasm › perinuclear region Ref.5. Isoform PDE9A3: Cytoplasm. Endoplasmic reticulum Ref.5. Isoform PDE9A17: Cytoplasm. Endoplasmic reticulum Ref.5. |
| Tissue specificity | Expressed in all tissues examined (testis, brain, small intestine, skeletal muscle, heart, lung, thymus, spleen, placenta, kidney, liver, pancreas, ovary and prostate) except blood. Highest levels in brain, heart, kidney, spleen, prostate and colon. Isoform PDE9A12 is found in prostate. Ref.3 |
| Domain | Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. PDE9 subfamily. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TRIM32 | Q13049 | 3 | EBI-742764,EBI-742790 |
Alternative products
| This entry describes 16 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PDE9A1 (identifier: O76083-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PDE9A2 (identifier: O76083-2) The sequence of this isoform differs from the canonical sequence as follows: 88-147: Missing. | ||||||
| Isoform PDE9A3 (identifier: O76083-3) The sequence of this isoform differs from the canonical sequence as follows: 1-73: MGSGSSSYRP...DPTMPANSER → MDAFRS 88-147: Missing. | ||||||
| Isoform PDE9A4 (identifier: O76083-4) The sequence of this isoform differs from the canonical sequence as follows: 24-165: VIFSKYCNSS...VLAQVAEQFS → HSVQSETCGHQATL | ||||||
| Isoform PDE9A5 (identifier: O76083-5) The sequence of this isoform differs from the canonical sequence as follows: 74-165: TPYKVRPVAI...VLAQVAEQFS → NELILYTSLR...SETCGHQATL | ||||||
| Isoform PDE9A6 (identifier: O76083-6) Also known as: PDE9A5; The sequence of this isoform differs from the canonical sequence as follows: 1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR 88-147: Missing. | ||||||
| Isoform PDE9A7 (identifier: O76083-7) Also known as: PDE9A8; PDE9A14; PDE9A19; PDE9A20; The sequence of this isoform differs from the canonical sequence as follows: 1-207: Missing. | ||||||
| Isoform PDE9A9 (identifier: O76083-8) The sequence of this isoform differs from the canonical sequence as follows: 48-73: Missing. 88-147: Missing. | ||||||
| Isoform PDE9A10 (identifier: O76083-9) The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. 161-165: AEQFS → MDAFR | ||||||
| Isoform PDE9A11 (identifier: O76083-10) Also known as: PDE9A15; The sequence of this isoform differs from the canonical sequence as follows: 1-217: Missing. 218-218: R → M | ||||||
| Isoform PDE9A12 (identifier: O76083-11) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR 73-165: Missing. | ||||||
| Isoform PDE9A13 (identifier: O76083-12) The sequence of this isoform differs from the canonical sequence as follows: 24-165: VIFSKYCNSS...VLAQVAEQFS → EHDHLPADHR...SETCGHQATL | ||||||
| Isoform PDE9A16 (identifier: O76083-13) The sequence of this isoform differs from the canonical sequence as follows: 1-73: MGSGSSSYRP...DPTMPANSER → MDAFRS | ||||||
| Isoform PDE9A17 (identifier: O76083-14) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR | ||||||
| Isoform PDE9A18 (identifier: O76083-15) The sequence of this isoform differs from the canonical sequence as follows: 48-73: Missing. | ||||||
| Isoform PDE9A21 (identifier: O76083-16) The sequence of this isoform differs from the canonical sequence as follows: 1-73: MGSGSSSYRP...DPTMPANSER → MSSFSIHHSVTCCFYLVRSHGRPTS 88-147: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 593 | 593 | High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A | PRO_0000198841 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 312 – 316 | 5 | cGMP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 512 – 513 | 2 | cGMP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 288 – 550 | 263 | Catalytic By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 312 | 1 | Proton donor | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 316 | 1 | Divalent metal cation 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 352 | 1 | Divalent metal cation 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 353 | 1 | Divalent metal cation 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 353 | 1 | Divalent metal cation 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 462 | 1 | Divalent metal cation 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 353 | 1 | cGMP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 462 | 1 | cGMP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 484 | 1 | cGMP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 217 | 217 | Missing in isoform PDE9A11. | VSP_017302 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 207 | 207 | Missing in isoform PDE9A7. | VSP_017303 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 160 | 160 | Missing in isoform PDE9A10. | VSP_017304 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 73 | 73 | MGSGS…ANSER → MSSFSIHHSVTCCFYLVRSH GRPTS in isoform PDE9A21. | VSP_038647 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 73 | 73 | MGSGS…ANSER → MDAFRS in isoform PDE9A3 and isoform PDE9A16. | VSP_004598 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 46 | 46 | MGSGS…ATGLP → MDAFR in isoform PDE9A6, isoform PDE9A12 and isoform PDE9A17. | VSP_017305 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 24 – 165 | 142 | VIFSK…AEQFS → EHDHLPADHRRRHGLHRPHH AREFRTHSVQSETCGHQATL in isoform PDE9A13. | VSP_017306 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 24 – 165 | 142 | VIFSK…AEQFS → HSVQSETCGHQATL in isoform PDE9A4. | VSP_004600 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 48 – 73 | 26 | Missing in isoform PDE9A9 and isoform PDE9A18. | VSP_017307 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 73 – 165 | 93 | Missing in isoform PDE9A12. | VSP_017308 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 74 – 165 | 92 | TPYKV…AEQFS → NELILYTSLRNLLFLPSKES WASHQHSVQSETCGHQATL in isoform PDE9A5. | VSP_017309 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 88 – 147 | 60 | Missing in isoform PDE9A2, isoform PDE9A3, isoform PDE9A6, isoform PDE9A9 and isoform PDE9A21. | VSP_004599 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 161 – 165 | 5 | AEQFS → MDAFR in isoform PDE9A10. | VSP_017310 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 218 | 1 | R → M in isoform PDE9A11. | VSP_017311 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 312 | 1 | H → A: Completely abolishes catalytic activity. Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 356 | 1 | H → A: Reduces catalytic activity, but has no effect on substrate affinity. Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 79 | 1 | R → G in BAG57446. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 250 – 255 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 263 – 265 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 268 – 281 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 284 – 288 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 292 – 305 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 310 – 313 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 314 – 330 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 336 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 339 – 351 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 352 – 355 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 361 – 367 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 370 – 375 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 380 – 393 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 396 – 398 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 400 – 403 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 406 – 422 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 425 – 427 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 428 – 439 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 447 – 462 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 465 – 467 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 470 – 494 | 25 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 500 – 502 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 504 – 506 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 509 – 519 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 521 – 531 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 535 – 561 | 27 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 562 – 564 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of PDE9A, a novel human cGMP-specific phosphodiesterase." Fisher D.A., Smith J.F., Pillar J.S., St Denis S.H., Cheng J.B. J. Biol. Chem. 273:15559-15564(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE9A1). Tissue: Brain, Prostate and Testis. |
| [2] | "Identification and characterization of a novel cyclic nucleotide phosphodiesterase gene (PDE9A) that maps to 21q22.3: alternative splicing of mRNA transcripts, genomic structure and sequence." Guipponi M., Scott H.S., Kudoh J., Kawasaki K., Shibuya K., Shintani A., Asakawa S., Chen H., Lalioti M.D., Rossier C., Minoshima S., Shimizu N., Antonarakis S.E. Hum. Genet. 103:386-392(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS PDE9A1; PDE9A2; PDE9A3 AND PDE9A4). Tissue: Fetal brain. |
| [3] | "Identification and distribution of different mRNA variants produced by differential splicing in the human phosphodiesterase 9A gene." Rentero C., Monfort A., Puigdomenech P. Biochem. Biophys. Res. Commun. 301:686-692(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PDE9A5; PDE9A6; PDE9A7; PDE9A9; PDE9A10; PDE9A11; PDE9A12; PDE9A13; PDE9A16; PDE9A17 AND PDE9A18), TISSUE SPECIFICITY. |
| [4] | "Identification and characterization of a new human type 9 cGMP-specific phosphodiesterase splice variant (PDE9A5). Differential tissue distribution and subcellular localization of PDE9A variants." Wang P., Wu P., Egan R.W., Billah M.M. Gene 314:15-27(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE9A6). Tissue: Brain, Small intestine and Spleen. |
| [5] | "Specific use of start codons and cellular localization of splice variants of human phosphodiesterase 9A gene." Rentero C., Puigdomenech P. BMC Mol. Biol. 7:39-39(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE9A21), SUBCELLULAR LOCATION. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS PDE9A1 AND PDE9A3). |
| [7] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE9A2). |
| [8] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE9A2). Tissue: Eye. |
| [11] | "Crystal structure of phosphodiesterase 9 shows orientation variation of inhibitor 3-isobutyl-1-methylxanthine binding." Huai Q., Wang H., Zhang W., Colman R.W., Robinson H., Ke H. Proc. Natl. Acad. Sci. U.S.A. 101:9624-9629(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.23 ANGSTROMS) OF 241-566 IN COMPLEX WITH THE INHIBITOR IBMX. |
| [12] | "Structural basis for the catalytic mechanism of human phosphodiesterase 9." Liu S., Mansour M.N., Dillman K.S., Perez J.R., Danley D.E., Aeed P.A., Simons S.P., Lemotte P.K., Menniti F.S. Proc. Natl. Acad. Sci. U.S.A. 105:13309-13314(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 242-566 IN COMPLEX WITH MAGNESIUM; MANGANESE; ZINC; GMP AND CGMP, FUNCTION, COFACTOR, MUTAGENESIS OF HIS-312 AND HIS-356. |
| [13] | "Crystal structure of the human phosphodiesterase 9a catalytic domain." RIKEN structural genomics initiative (RSGI) Submitted (FEB-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.80 ANGSTROMS) OF 241-566. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF048837 mRNA. Translation: AAC39778.1. AB017602 Genomic DNA. Translation: BAA88847.1. AF067223 mRNA. Translation: AAC26723.1. AF067224 mRNA. Translation: AAC26724.1. AF067225 mRNA. Translation: AAC26725.1. AF067226 mRNA. Translation: AAC26726.1. AY196299 mRNA. Translation: AAO34685.1. AY196300 mRNA. Translation: AAO34686.1. AY196301 mRNA. Translation: AAO34687.1. AY196302 mRNA. Translation: AAO34688.1. AY196303 mRNA. Translation: AAO34689.1. AY196304 mRNA. Translation: AAO34690.1. AY196305 mRNA. Translation: AAO34691.1. AY196306 mRNA. Translation: AAO34692.1. AY196307 mRNA. Translation: AAO34693.1. AY196308 mRNA. Translation: AAO34694.1. AY196309 mRNA. Translation: AAO34695.1. AY196310 mRNA. Translation: AAO34696.1. AY196311 mRNA. Translation: AAO34697.1. AY196312 mRNA. Translation: AAO34698.1. AY196313 mRNA. Translation: AAO34699.1. AY196314 mRNA. Translation: AAO34700.1. AY242121 mRNA. Translation: AAO88210.1. AY701187 mRNA. Translation: AAV84271.1. AK294112 mRNA. Translation: BAG57446.1. AK314679 mRNA. Translation: BAG37232.1. BT007016 mRNA. Translation: AAP35662.1. AP001747 Genomic DNA. Translation: BAA95552.1. CH471079 Genomic DNA. Translation: EAX09544.1. CH471079 Genomic DNA. Translation: EAX09536.1. CH471079 Genomic DNA. Translation: EAX09537.1. CH471079 Genomic DNA. Translation: EAX09541.1. CH471079 Genomic DNA. Translation: EAX09542.1. CH471079 Genomic DNA. Translation: EAX09546.1. CH471079 Genomic DNA. Translation: EAX09540.1. CH471079 Genomic DNA. Translation: EAX09548.1. CH471079 Genomic DNA. Translation: EAX09549.1. BC009047 mRNA. Translation: AAH09047.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00008806. IPI00221058. IPI00221059. IPI00221060. IPI00384465. IPI00384467. IPI00418691. IPI00418692. IPI00418694. IPI00419056. IPI00419057. IPI00419058. IPI00419059. IPI00419063. IPI00873811. IPI00954837. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001001567.1. NM_001001567.1. NP_001001568.1. NM_001001568.1. NP_001001569.1. NM_001001569.1. NP_001001570.1. NM_001001570.1. NP_001001571.1. NM_001001571.1. NP_001001572.1. NM_001001572.1. NP_001001573.1. NM_001001573.1. NP_001001574.1. NM_001001574.1. NP_001001575.1. NM_001001575.1. NP_001001576.1. NM_001001576.1. NP_001001577.1. NM_001001577.1. NP_001001578.1. NM_001001578.1. NP_001001579.1. NM_001001579.1. NP_001001580.1. NM_001001580.1. NP_001001581.1. NM_001001581.1. NP_001001582.1. NM_001001582.1. NP_001001583.1. NM_001001583.1. NP_001001584.1. NM_001001584.2. NP_001001585.1. NM_001001585.1. NP_002597.1. NM_002606.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.473927. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | O76083. 2 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1444906. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 5152. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000291539; ENSP00000291539; ENSG00000160191. ENST00000328862; ENSP00000328699; ENSG00000160191. ENST00000335440; ENSP00000335365; ENSG00000160191. ENST00000335512; ENSP00000335242; ENSG00000160191. ENST00000349112; ENSP00000344730; ENSG00000160191. ENST00000380328; ENSP00000369685; ENSG00000160191. ENST00000398224; ENSP00000381280; ENSG00000160191. ENST00000398225; ENSP00000381281; ENSG00000160191. ENST00000398227; ENSP00000381283; ENSG00000160191. ENST00000398229; ENSP00000381285; ENSG00000160191. ENST00000398232; ENSP00000381287; ENSG00000160191. ENST00000398234; ENSP00000381289; ENSG00000160191. ENST00000398236; ENSP00000381291; ENSG00000160191. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5152. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5152. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002zbm.3. human. uc002zbn.3. human. uc002zbo.3. human. uc002zbq.3. human. uc002zbt.3. human. uc002zbu.3. human. uc002zbv.3. human. uc002zbw.3. human. uc002zbx.3. human. uc002zbz.3. human. uc002zca.3. human. uc002zcb.3. human. uc002zcc.3. human. uc002zcd.3. human. uc002zce.3. human. uc010gpf.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 5152. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC21P044073. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:8795. PDE9A. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA011380. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 602973. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA33143. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG268427. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG053545. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K13761. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | YPKYMLS. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4G4GQ5. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | ar_tf_pathway. Regulation of Androgen receptor activity. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_604. Hemostasis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000160191. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 1.10.1300.10. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR003607. HD/PDEase_dom. IPR023088. PDEase. IPR002073. PDEase_catalytic_dom. IPR023174. PDEase_CS. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00233. PDEase_I. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00387. PDIESTERASE1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00471. HDc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00126. PDEASE_I. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL3535. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | PDE9A. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 5152. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 19884. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PDE9A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O76083 Secondary accession number(s): B2RBI5 Q86WP0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
