Reviewed,
UniProtKB/Swiss-Prot O76083 (PDE9A_HUMAN)
Last modified
June 16, 2009.
Version 84.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A EC=3.1.4.35 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 593 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase has a high affinity for cGMP. |
| Catalytic activity | Guanosine 3',5'-cyclic phosphate + H2O = guanosine 5'-phosphate. |
| Cofactor | Divalent cations. Preferably manganese. |
| Enzyme regulation | Inhibited by zaprinast. |
| Tissue specificity | Expressed in all tissues examined (testis, brain, small intestine, skeletal muscle, heart, lung, thymus, spleen, placenta, kidney, liver, pancreas, ovary and prostate) except blood. Highest levels in brain, heart, kidney, spleen, prostate and colon. Isoform PDE9A12 is found in prostate. Ref.3 |
| Domain | Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain. |
| Involvement in disease | May be involved in affective bipolar disorder. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Manganese Metal-binding cGMP |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | signal transduction Ref.2 Traceable author statement. Source: ProtInc |
| Cellular component | cytosol Inferred from direct assay. Source: UniProtKB |
| Molecular function | 3',5'-cyclic-GMP phosphodiesterase activity Inferred from electronic annotation. Source: EC manganese ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 15 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PDE9A1 (identifier: O76083-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PDE9A2 (identifier: O76083-2) The sequence of this isoform differs from the canonical sequence as follows: 88-147: Missing. | ||||||
| Isoform PDE9A3 (identifier: O76083-3) The sequence of this isoform differs from the canonical sequence as follows: 1-73: MGSGSSSYRP...DPTMPANSER → MDAFRS 88-147: Missing. | ||||||
| Isoform PDE9A4 (identifier: O76083-4) The sequence of this isoform differs from the canonical sequence as follows: 24-165: VIFSKYCNSS...VLAQVAEQFS → HSVQSETCGHQATL | ||||||
| Isoform PDE9A5 (identifier: O76083-5) The sequence of this isoform differs from the canonical sequence as follows: 74-165: TPYKVRPVAI...VLAQVAEQFS → NELILYTSLR...SETCGHQATL | ||||||
| Isoform PDE9A6 (identifier: O76083-6) Also known as: PDE9A5; The sequence of this isoform differs from the canonical sequence as follows: 1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR 88-147: Missing. | ||||||
| Isoform PDE9A7/A8/A14/A19/A20 (identifier: O76083-7) The sequence of this isoform differs from the canonical sequence as follows: 1-207: Missing. | ||||||
| Isoform PDE9A9 (identifier: O76083-8) The sequence of this isoform differs from the canonical sequence as follows: 48-73: Missing. 88-147: Missing. | ||||||
| Isoform PDE9A10 (identifier: O76083-9) The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. 161-165: AEQFS → MDAFR | ||||||
| Isoform PDE9A11/A15 (identifier: O76083-10) The sequence of this isoform differs from the canonical sequence as follows: 1-217: Missing. 218-218: R → M | ||||||
| Isoform PDE9A12 (identifier: O76083-11) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR 73-165: Missing. | ||||||
| Isoform PDE9A13 (identifier: O76083-12) The sequence of this isoform differs from the canonical sequence as follows: 24-165: VIFSKYCNSS...VLAQVAEQFS → EHDHLPADHR...SETCGHQATL | ||||||
| Isoform PDE9A16 (identifier: O76083-13) The sequence of this isoform differs from the canonical sequence as follows: 1-73: MGSGSSSYRP...DPTMPANSER → MDAFRS | ||||||
| Isoform PDE9A17 (identifier: O76083-14) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR | ||||||
| Isoform PDE9A18 (identifier: O76083-15) The sequence of this isoform differs from the canonical sequence as follows: 48-73: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 593 | 593 | High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A | PRO_0000198841 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 288 – 550 | 263 | Catalytic By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 312 | 1 | Manganese 1 Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 316 | 1 | Manganese 1 Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 341 | 1 | Manganese 1 Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 352 | 1 | Manganese 2 Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 356 | 1 | Manganese 2 Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 382 | 1 | Manganese 2 Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 29 | 1 | Phosphotyrosine Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 217 | 217 | Missing in isoform PDE9A11/A15. | VSP_017302 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 207 | 207 | Missing in isoform PDE9A7/A8/A14/A19/A20. | VSP_017303 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 160 | 160 | Missing in isoform PDE9A10. | VSP_017304 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 73 | 73 | MGSGS…ANSER → MDAFRS in isoform PDE9A3 and isoform PDE9A16. | VSP_004598 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 46 | 46 | MGSGS…ATGLP → MDAFR in isoform PDE9A6, isoform PDE9A12 and isoform PDE9A17. | VSP_017305 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 24 – 165 | 142 | VIFSK…AEQFS → EHDHLPADHRRRHGLHRPHH AREFRTHSVQSETCGHQATL in isoform PDE9A13. | VSP_017306 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 24 – 165 | 142 | VIFSK…AEQFS → HSVQSETCGHQATL in isoform PDE9A4. | VSP_004600 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 48 – 73 | 26 | Missing in isoform PDE9A9 and isoform PDE9A18. | VSP_017307 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 73 – 165 | 93 | Missing in isoform PDE9A12. | VSP_017308 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 74 – 165 | 92 | TPYKV…AEQFS → NELILYTSLRNLLFLPSKES WASHQHSVQSETCGHQATL in isoform PDE9A5. | VSP_017309 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 88 – 147 | 60 | Missing in isoform PDE9A2, isoform PDE9A3, isoform PDE9A6 and isoform PDE9A9. | VSP_004599 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 161 – 165 | 5 | AEQFS → MDAFR in isoform PDE9A10. | VSP_017310 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 218 | 1 | R → M in isoform PDE9A11/A15. | VSP_017311 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 250 – 255 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 268 – 281 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 284 – 287 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 292 – 304 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 310 – 313 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 314 – 330 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 336 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 339 – 351 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 352 – 355 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 361 – 366 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 370 – 374 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 375 – 377 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 380 – 393 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 396 – 398 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 400 – 403 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 406 – 421 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 425 – 427 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 428 – 438 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 439 – 441 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 447 – 462 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 465 – 467 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 470 – 493 | 24 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 500 – 502 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 504 – 506 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 509 – 519 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 521 – 531 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 535 – 560 | 26 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of PDE9A, a novel human cGMP-specific phosphodiesterase." Fisher D.A., Smith J.F., Pillar J.S., St Denis S.H., Cheng J.B. J. Biol. Chem. 273:15559-15564(1998) [PubMed: 9624146] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE9A1). Tissue: Brain, Prostate and Testis. |
| [2] | "Identification and characterization of a novel cyclic nucleotide phosphodiesterase gene (PDE9A) that maps to 21q22.3: alternative splicing of mRNA transcripts, genomic structure and sequence." Guipponi M., Scott H.S., Kudoh J., Kawasaki K., Shibuya K., Shintani A., Asakawa S., Chen H., Lalioti M.D., Rossier C., Minoshima S., Shimizu N., Antonarakis S.E. Hum. Genet. 103:386-392(1998) [PubMed: 9856478] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PDE9A1; PDE9A2; PDE9A3 AND PDE9A4). Tissue: Fetal brain. |
| [3] | "Identification and distribution of different mRNA variants produced by differential splicing in the human phosphodiesterase 9A gene." Rentero C., Monfort A., Puigdomenech P. Biochem. Biophys. Res. Commun. 301:686-692(2003) [PubMed: 12565835] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PDE9A5; PDE9A6; PDE9A7/A8/A14/A19/A20; PDE9A9; PDE9A10; PDE9A11/A15; PDE9A13; PDE9A16; PDE9A17 AND PDE9A18), TISSUE SPECIFICITY. |
| [4] | "Identification and characterization of a new human type 9 cGMP-specific phosphodiesterase splice variant (PDE9A5). Differential tissue distribution and subcellular localization of PDE9A variants." Wang P., Wu P., Egan R.W., Billah M.M. Gene 314:15-27(2003) [PubMed: 14527714] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE9A6). Tissue: Brain, Small intestine and Spleen. |
| [5] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed: 10830953] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE9A2). Tissue: Eye. |
| [7] | "Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling." Wang Y., Du D., Fang L., Yang G., Zhang C., Zeng R., Ullrich A., Lottspeich F., Chen Z. EMBO J. 25:5058-5070(2006) [PubMed: 17053785] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-29, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF048837 mRNA. Translation: AAC39778.1. AF067223 mRNA. Translation: AAC26723.1. AF067224 mRNA. Translation: AAC26724.1. AF067225 mRNA. Translation: AAC26725.1. AF067226 mRNA. Translation: AAC26726.1. AY196299 mRNA. Translation: AAO34685.1. AY196300 mRNA. Translation: AAO34686.1. AY196301 mRNA. Translation: AAO34687.1. AY196302 mRNA. Translation: AAO34688.1. AY196303 mRNA. Translation: AAO34689.1. AY196304 mRNA. Translation: AAO34690.1. AY196305 mRNA. Translation: AAO34691.1. AY196306 mRNA. Translation: AAO34692.1. AY196307 mRNA. Translation: AAO34693.1. AY196308 mRNA. Translation: AAO34694.1. AY196309 mRNA. Translation: AAO34695.1. AY196310 mRNA. Translation: AAO34696.1. AY196311 mRNA. Translation: AAO34697.1. AY196312 mRNA. Translation: AAO34698.1. AY196313 mRNA. Translation: AAO34699.1. AY196314 mRNA. Translation: AAO34700.1. AY242121 mRNA. Translation: AAO88210.1. AB017602 Genomic DNA. Translation: BAA88847.1. AP001747 Genomic DNA. Translation: BAA95552.1. BC009047 mRNA. Translation: AAH09047.1. | |||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00008806. IPI00221058. IPI00221059. IPI00221060. IPI00384465. IPI00384467. IPI00418691. IPI00418692. IPI00418694. IPI00419056. IPI00419057. IPI00419058. IPI00419059. IPI00419063. IPI00873811. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001001567.1. NP_001001568.1. NP_001001569.1. NP_001001570.1. NP_001001571.1. NP_001001572.1. NP_001001573.1. NP_001001574.1. NP_001001575.1. NP_001001576.1. NP_001001577.1. NP_001001578.1. NP_001001579.1. NP_001001580.1. NP_001001581.1. NP_001001582.1. NP_001001583.1. NP_001001584.1. NP_001001585.1. NP_002597.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.473927 | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | O76083. 3 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSG00000160191. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5152. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5152. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC21P042946. | ||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0016144. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:8795. PDE9A. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA011380. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 602973. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA33143. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | O76083. ILVLMTA. | ||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 3.1.4.35. 247. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | ar_tf_pathway. Regulation of Androgen receptor activity. | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000160191. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR003607. Met-dep_phosphohydro_HD. IPR002073. PDEase. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00233. PDEase_I. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00387. PDIESTERASE1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00471. HDc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00126. PDEASE_I. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | O76083. | ||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 19884. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PDE9A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O76083 Secondary accession number(s): O75490 Q86WP0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


