Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O76075

- DFFB_HUMAN

UniProt

O76075 - DFFB_HUMAN

Protein

DNA fragmentation factor subunit beta

Gene

DFFB

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 1 (01 Nov 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. Degrades naked DNA and induces apoptotic morphology.

    Enzyme regulationi

    Inhibited by DFFA (DFF45).

    GO - Molecular functioni

    1. deoxyribonuclease activity Source: RefGenome
    2. DNA binding Source: Ensembl
    3. enzyme binding Source: UniProtKB
    4. nicotinate phosphoribosyltransferase activity Source: Ensembl

    GO - Biological processi

    1. apoptotic chromosome condensation Source: UniProtKB
    2. apoptotic DNA fragmentation Source: MGI
    3. apoptotic process Source: Reactome
    4. brain development Source: Ensembl
    5. cellular component disassembly involved in execution phase of apoptosis Source: Reactome

    Keywords - Molecular functioni

    Hydrolase, Nuclease

    Keywords - Biological processi

    Apoptosis

    Enzyme and pathway databases

    ReactomeiREACT_13462. Activation of DNA fragmentation factor.
    SignaLinkiO76075.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    DNA fragmentation factor subunit beta (EC:3.-.-.-)
    Alternative name(s):
    Caspase-activated deoxyribonuclease
    Short name:
    CAD
    Short name:
    Caspase-activated DNase
    Caspase-activated nuclease
    Short name:
    CPAN
    DNA fragmentation factor 40 kDa subunit
    Short name:
    DFF-40
    Gene namesi
    Name:DFFB
    Synonyms:CAD, DFF2, DFF40
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:2773. DFFB.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: UniProtKB
    2. nuclear chromatin Source: UniProtKB
    3. nucleoplasm Source: Reactome
    4. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27255.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 338338DNA fragmentation factor subunit betaPRO_0000144713Add
    BLAST

    Proteomic databases

    MaxQBiO76075.
    PaxDbiO76075.
    PRIDEiO76075.

    PTM databases

    PhosphoSiteiO76075.

    Expressioni

    Gene expression databases

    ArrayExpressiO76075.
    BgeeiO76075.
    CleanExiHS_CAD.
    HS_DFFB.
    GenevestigatoriO76075.

    Organism-specific databases

    HPAiCAB004328.

    Interactioni

    Subunit structurei

    Heterodimer of DFFA and DFFB. Interacts with HIST1H1A.1 Publication

    Protein-protein interaction databases

    BioGridi108041. 14 interactions.
    IntActiO76075. 8 interactions.
    MINTiMINT-365482.
    STRINGi9606.ENSP00000367454.

    Structurei

    Secondary structure

    1
    338
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi9 – 113
    Beta strandi13 – 164
    Helixi26 – 3611
    Turni41 – 433
    Beta strandi44 – 518
    Beta strandi57 – 593
    Beta strandi69 – 724
    Beta strandi74 – 763

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1IBXNMR-A1-80[»]
    ProteinModelPortaliO76075.
    SMRiO76075. Positions 1-326.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO76075.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini4 – 8077CIDE-NPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 CIDE-N domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG68641.
    HOGENOMiHOG000006502.
    HOVERGENiHBG003828.
    InParanoidiO76075.
    KOiK02311.
    OMAiAGQTWQG.
    OrthoDBiEOG712TW8.
    PhylomeDBiO76075.
    TreeFamiTF102022.

    Family and domain databases

    InterProiIPR015311. Apoptosis_DFF40.
    IPR003508. CIDE-N_dom.
    [Graphical view]
    PfamiPF02017. CIDE-N. 1 hit.
    PF09230. DFF40. 1 hit.
    [Graphical view]
    PROSITEiPS51135. CIDE_N. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform Alpha (identifier: O76075-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLQKPKSVKL RALRSPRKFG VAGRSCQEVL RKGCLRFQLP ERGSRLCLYE    50
    DGTELTEDYF PSVPDNAELV LLTLGQAWQG YVSDIRRFLS AFHEPQVGLI 100
    QAAQQLLCDE QAPQRQRLLA DLLHNVSQNI AAETRAEDPP WFEGLESRFQ 150
    SKSGYLRYSC ESRIRSYLRE VSSYPSTVGA EAQEEFLRVL GSMCQRLRSM 200
    QYNGSYFDRG AKGGSRLCTP EGWFSCQGPF DMDSCLSRHS INPYSNRESR 250
    ILFSTWNLDH IIEKKRTIIP TLVEAIKEQD GREVDWEYFY GLLFTSENLK 300
    LVHIVCHKKT THKLNCDPSR IYKPQTRLKR KQPVRKRQ 338
    Length:338
    Mass (Da):39,110
    Last modified:November 1, 1998 - v1
    Checksum:i0B0F3F8D91209389
    GO
    Isoform Beta (identifier: O76075-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         262-338: IEKKRTIIPT...KRKQPVRKRQ → DGVLLCGPG

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:270
    Mass (Da):30,649
    Checksum:i26AC88793BE46E7E
    GO
    Isoform Gamma (identifier: O76075-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         81-116: YVSDIRRFLSAFHEPQVGLIQAAQQLLCDEQAPQRQ → SVGVRARTKTRDTSSLSPGDCQALGNGGRCGQRLFL
         117-338: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:116
    Mass (Da):12,800
    Checksum:iF6C9A328ACBB54EE
    GO
    Isoform Delta (identifier: O76075-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         81-103: YVSDIRRFLSAFHEPQVGLIQAA → WFCHVSQDSLTLLGSSCPPALVS
         104-338: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:103
    Mass (Da):11,482
    Checksum:iF9BDC40AC25E4500
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti196 – 1961R → K.1 Publication
    Corresponds to variant rs12738235 [ dbSNP | Ensembl ].
    VAR_009305
    Natural varianti277 – 2771K → R.
    Corresponds to variant rs12564400 [ dbSNP | Ensembl ].
    VAR_048737

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei81 – 11636YVSDI…APQRQ → SVGVRARTKTRDTSSLSPGD CQALGNGGRCGQRLFL in isoform Gamma. 1 PublicationVSP_001081Add
    BLAST
    Alternative sequencei81 – 10323YVSDI…LIQAA → WFCHVSQDSLTLLGSSCPPA LVS in isoform Delta. 1 PublicationVSP_001083Add
    BLAST
    Alternative sequencei104 – 338235Missing in isoform Delta. 1 PublicationVSP_001084Add
    BLAST
    Alternative sequencei117 – 338222Missing in isoform Gamma. 1 PublicationVSP_001082Add
    BLAST
    Alternative sequencei262 – 33877IEKKR…VRKRQ → DGVLLCGPG in isoform Beta. 1 PublicationVSP_001080Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF064019 mRNA. Translation: AAC39920.1.
    AB013918 mRNA. Translation: BAA32250.1.
    AF039210 mRNA. Translation: AAC39709.1.
    AB028911 mRNA. Translation: BAB40447.1.
    AB028912 mRNA. Translation: BAB40448.1.
    AB028913 mRNA. Translation: BAB40449.1.
    AK290877 mRNA. Translation: BAF83566.1.
    AL691523 Genomic DNA. Translation: CAI17371.1.
    BC048797 mRNA. Translation: AAH48797.1.
    CCDSiCCDS52.1. [O76075-1]
    RefSeqiNP_004393.1. NM_004402.3. [O76075-1]
    UniGeneiHs.133089.

    Genome annotation databases

    EnsembliENST00000338895; ENSP00000339524; ENSG00000169598. [O76075-2]
    ENST00000339350; ENSP00000343218; ENSG00000169598. [O76075-3]
    ENST00000378209; ENSP00000367454; ENSG00000169598. [O76075-1]
    ENST00000491998; ENSP00000436775; ENSG00000169598. [O76075-2]
    GeneIDi1677.
    KEGGihsa:1677.
    UCSCiuc001alc.3. human. [O76075-1]
    uc009vlo.1. human. [O76075-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF064019 mRNA. Translation: AAC39920.1 .
    AB013918 mRNA. Translation: BAA32250.1 .
    AF039210 mRNA. Translation: AAC39709.1 .
    AB028911 mRNA. Translation: BAB40447.1 .
    AB028912 mRNA. Translation: BAB40448.1 .
    AB028913 mRNA. Translation: BAB40449.1 .
    AK290877 mRNA. Translation: BAF83566.1 .
    AL691523 Genomic DNA. Translation: CAI17371.1 .
    BC048797 mRNA. Translation: AAH48797.1 .
    CCDSi CCDS52.1. [O76075-1 ]
    RefSeqi NP_004393.1. NM_004402.3. [O76075-1 ]
    UniGenei Hs.133089.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1IBX NMR - A 1-80 [» ]
    ProteinModelPortali O76075.
    SMRi O76075. Positions 1-326.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 108041. 14 interactions.
    IntActi O76075. 8 interactions.
    MINTi MINT-365482.
    STRINGi 9606.ENSP00000367454.

    PTM databases

    PhosphoSitei O76075.

    Proteomic databases

    MaxQBi O76075.
    PaxDbi O76075.
    PRIDEi O76075.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000338895 ; ENSP00000339524 ; ENSG00000169598 . [O76075-2 ]
    ENST00000339350 ; ENSP00000343218 ; ENSG00000169598 . [O76075-3 ]
    ENST00000378209 ; ENSP00000367454 ; ENSG00000169598 . [O76075-1 ]
    ENST00000491998 ; ENSP00000436775 ; ENSG00000169598 . [O76075-2 ]
    GeneIDi 1677.
    KEGGi hsa:1677.
    UCSCi uc001alc.3. human. [O76075-1 ]
    uc009vlo.1. human. [O76075-2 ]

    Organism-specific databases

    CTDi 1677.
    GeneCardsi GC01P003797.
    HGNCi HGNC:2773. DFFB.
    HPAi CAB004328.
    MIMi 601883. gene.
    neXtProti NX_O76075.
    PharmGKBi PA27255.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG68641.
    HOGENOMi HOG000006502.
    HOVERGENi HBG003828.
    InParanoidi O76075.
    KOi K02311.
    OMAi AGQTWQG.
    OrthoDBi EOG712TW8.
    PhylomeDBi O76075.
    TreeFami TF102022.

    Enzyme and pathway databases

    Reactomei REACT_13462. Activation of DNA fragmentation factor.
    SignaLinki O76075.

    Miscellaneous databases

    EvolutionaryTracei O76075.
    GeneWikii DFFB.
    GenomeRNAii 1677.
    NextBioi 6902.
    PROi O76075.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O76075.
    Bgeei O76075.
    CleanExi HS_CAD.
    HS_DFFB.
    Genevestigatori O76075.

    Family and domain databases

    InterProi IPR015311. Apoptosis_DFF40.
    IPR003508. CIDE-N_dom.
    [Graphical view ]
    Pfami PF02017. CIDE-N. 1 hit.
    PF09230. DFF40. 1 hit.
    [Graphical view ]
    PROSITEi PS51135. CIDE_N. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The 40-kDa subunit of DNA fragmentation factor induces DNA fragmentation and chromatin condensation during apoptosis."
      Liu X., Li P., Widlak P., Zou H., Luo X., Garrard W.T., Wang X.
      Proc. Natl. Acad. Sci. U.S.A. 95:8461-8466(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
    2. "Molecular cloning and characterization of human caspase-activated DNase."
      Mukae N., Enari M., Sakahira H., Fukuda Y., Inazawa J., Toh H., Nagata S.
      Proc. Natl. Acad. Sci. U.S.A. 95:9123-9128(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
    3. "CPAN, a human nuclease regulated by the caspase-sensitive inhibitor DFF45."
      Halenbeck R., MacDonald H., Roulston A., Chen T.T., Conroy L., Williams L.T.
      Curr. Biol. 8:537-540(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
      Tissue: Pancreas.
    4. "DFF40 delta."
      Nakagawara A., Takahashi M., Takada N., Kawamoto T.
      Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BETA; GAMMA AND DELTA).
      Tissue: Fetal brain.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
    6. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
      Tissue: Lung.
    8. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
    9. "Histone H1 subtype preferences of DFF40 and possible nuclear localization of DFF40/45 in normal and trichostatin A-treated NB4 leukemic cells."
      Ninios Y.P., Sekeri-Pataryas K.E., Sourlingas T.G.
      Apoptosis 15:128-138(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH HIST1H1A.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Structure and mutation analysis of the gene encoding DNA fragmentation factor 40 (caspase-activated nuclease), a candidate neuroblastoma tumour suppressor gene."
      Judson H., van Roy N., Strain L., Vandesompele J., Van Gele M., Speleman F., Bonthron D.T.
      Hum. Genet. 106:406-413(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT LYS-196.

    Entry informationi

    Entry nameiDFFB_HUMAN
    AccessioniPrimary (citable) accession number: O76075
    Secondary accession number(s): O60521
    , Q5SR22, Q9BYI4, Q9BYI5, Q9BYI6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: November 1, 1998
    Last modified: October 1, 2014
    This is version 129 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3