Reviewed,
UniProtKB/Swiss-Prot O76075 (DFFB_HUMAN)
Last modified
June 16, 2009.
Version 82.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: DNA fragmentation factor subunit beta EC=3.-.-.- Alternative name(s): DNA fragmentation factor 40 kDa subunit Short name=DFF-40 Caspase-activated deoxyribonuclease Short name=Caspase-activated DNase Short name=CAD Short name=Caspase-activated nuclease Short name=CPAN | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 338 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. Degrades naked DNA and induces apoptotic morphology. |
| Enzyme regulation | Inhibited by DFFA (DFF45). |
| Subunit structure | Heterodimer of DFFA and DFFB. |
| Subcellular location | |
| Sequence similarities | Contains 1 CIDE-N domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Hydrolase Nuclease |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | DNA fragmentation involved in apoptosis Inferred from direct assay. Source: MGI apoptotic chromosome condensationInferred from direct assay. Source: UniProtKB intracellular signaling cascadeTraceable author statement. Source: ProtInc |
| Cellular component | cytosol Traceable author statement. Source: ProtInc nucleoplasmInferred from Experiment. Source: Reactome |
| Molecular function | caspase-activated deoxyribonuclease activity Ref.1 Traceable author statement. Source: ProtInc enzyme bindingInferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha (identifier: O76075-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Beta (identifier: O76075-2) The sequence of this isoform differs from the canonical sequence as follows: 262-338: IEKKRTIIPT...KRKQPVRKRQ → DGVLLCGPG | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform Gamma (identifier: O76075-3) The sequence of this isoform differs from the canonical sequence as follows: 81-116: YVSDIRRFLSAFHEPQVGLIQAAQQLLCDEQAPQRQ → SVGVRARTKTRDTSSLSPGDCQALGNGGRCGQRLFL 117-338: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform Delta (identifier: O76075-4) The sequence of this isoform differs from the canonical sequence as follows: 81-103: YVSDIRRFLSAFHEPQVGLIQAA → WFCHVSQDSLTLLGSSCPPALVS 104-338: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 338 | 338 | DNA fragmentation factor subunit beta | PRO_0000144713 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Domain | 4 – 80 | 77 | CIDE-N | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 81 – 116 | 36 | YVSDI…APQRQ → SVGVRARTKTRDTSSLSPGD CQALGNGGRCGQRLFL in isoform Gamma. | VSP_001081 | ||||||||||||||||||||
| Alternative sequence | 81 – 103 | 23 | YVSDI…LIQAA → WFCHVSQDSLTLLGSSCPPA LVS in isoform Delta. | VSP_001083 | ||||||||||||||||||||
| Alternative sequence | 104 – 338 | 235 | Missing in isoform Delta. | VSP_001084 | ||||||||||||||||||||
| Alternative sequence | 117 – 338 | 222 | Missing in isoform Gamma. | VSP_001082 | ||||||||||||||||||||
| Alternative sequence | 262 – 338 | 77 | IEKKR…VRKRQ → DGVLLCGPG in isoform Beta. | VSP_001080 | ||||||||||||||||||||
| Natural variant | 196 | 1 | R → K: dbSNP rs12738235. Ref.7 | VAR_009305 | ||||||||||||||||||||
| Natural variant | 277 | 1 | K → R: dbSNP rs12564400. | VAR_048737 | ||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Beta strand | 9 – 11 | 3 | ||||||||||||||||||||||
| Beta strand | 13 – 16 | 4 | ||||||||||||||||||||||
| Helix | 26 – 36 | 11 | ||||||||||||||||||||||
| Turn | 41 – 43 | 3 | ||||||||||||||||||||||
| Beta strand | 44 – 51 | 8 | ||||||||||||||||||||||
| Beta strand | 57 – 59 | 3 | ||||||||||||||||||||||
| Beta strand | 69 – 72 | 4 | ||||||||||||||||||||||
| Beta strand | 74 – 76 | 3 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The 40-kDa subunit of DNA fragmentation factor induces DNA fragmentation and chromatin condensation during apoptosis." Liu X., Li P., Widlak P., Zou H., Luo X., Garrard W.T., Wang X. Proc. Natl. Acad. Sci. U.S.A. 95:8461-8466(1998) [PubMed: 9671700] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA). |
| [2] | "Molecular cloning and characterization of human caspase-activated DNase." Mukae N., Enari M., Sakahira H., Fukuda Y., Inazawa J., Toh H., Nagata S. Proc. Natl. Acad. Sci. U.S.A. 95:9123-9128(1998) [PubMed: 9689044] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA). |
| [3] | "CPAN, a human nuclease regulated by the caspase-sensitive inhibitor DFF45." Halenbeck R., MacDonald H., Roulston A., Chen T.T., Conroy L., Williams L.T. Curr. Biol. 8:537-540(1998) [PubMed: 9560346] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA). Tissue: Pancreas. |
| [4] | "DFF40 delta." Nakagawara A., Takahashi M., Takada N., Kawamoto T. Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BETA; GAMMA AND DELTA). Tissue: Fetal brain. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). Tissue: Lung. |
| [6] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:RESEARCH008.1-RESEARCH008.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [7] | "Structure and mutation analysis of the gene encoding DNA fragmentation factor 40 (caspase-activated nuclease), a candidate neuroblastoma tumour suppressor gene." Judson H., van Roy N., Strain L., Vandesompele J., Van Gele M., Speleman F., Bonthron D.T. Hum. Genet. 106:406-413(2000) [PubMed: 10830907] [Abstract] Cited for: VARIANT LYS-196. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF064019 mRNA. Translation: AAC39920.1. AB013918 mRNA. Translation: BAA32250.1. AF039210 mRNA. Translation: AAC39709.1. AB028911 mRNA. Translation: BAB40447.1. AB028912 mRNA. Translation: BAB40448.1. AB028913 mRNA. Translation: BAB40449.1. BC048797 mRNA. Translation: AAH48797.1. | |||||||||||||
| IPI | IPI00008794. IPI00179341. IPI00218518. IPI00883793. | ||||||||||||
| RefSeq | NP_004393.1. | ||||||||||||
| UniGene | Hs.133089 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| SMR | O76075. Positions 82-326. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O76075. 1 interaction. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | O76075. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000169598. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 1677. | ||||||||||||
| KEGG | hsa:1677. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC01P003797. | ||||||||||||
| HGNC | HGNC:2773. DFFB. | ||||||||||||
| HPA | CAB004328. | ||||||||||||
| MIM | 601883. gene. | ||||||||||||
| PharmGKB | PA27255. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOGENOM | O76075. | ||||||||||||
| HOVERGEN | O76075. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. faspathway. FAS signaling pathway (CD95). hivnefpathway. HIV-1 Nef: Negative effector of Fas and TNF-alpha. | ||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O76075. | ||||||||||||
| Bgee | O76075. | ||||||||||||
| CleanEx | HS_CAD. HS_DFFB. | ||||||||||||
| GermOnline | ENSG00000169598. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR015311. Apoptosis_DFF40. IPR003508. CAD. [Graphical view] | ||||||||||||
| Pfam | PF02017. CIDE-N. 1 hit. PF09230. DFF40. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS51135. CIDE_N. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 6902. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | DFFB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O76075 Secondary accession number(s): O60521 Q9BYI6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


