O76075 (DFFB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DNA fragmentation factor subunit beta EC=3.-.-.- Alternative name(s): Caspase-activated deoxyribonuclease Short name=CAD Short name=Caspase-activated DNase Caspase-activated nuclease Short name=CPAN DNA fragmentation factor 40 kDa subunit Short name=DFF-40 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 338 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. Degrades naked DNA and induces apoptotic morphology. |
| Enzyme regulation | Inhibited by DFFA (DFF45). |
| Subunit structure | Heterodimer of DFFA and DFFB. Interacts with HIST1H1A. Ref.9 |
| Subcellular location | |
| Sequence similarities | Contains 1 CIDE-N domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DFFA | O00273 | 1 | EBI-1053821,EBI-727171 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha (identifier: O76075-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Beta (identifier: O76075-2) The sequence of this isoform differs from the canonical sequence as follows: 262-338: IEKKRTIIPT...KRKQPVRKRQ → DGVLLCGPG | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform Gamma (identifier: O76075-3) The sequence of this isoform differs from the canonical sequence as follows: 81-116: YVSDIRRFLSAFHEPQVGLIQAAQQLLCDEQAPQRQ → SVGVRARTKTRDTSSLSPGDCQALGNGGRCGQRLFL 117-338: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform Delta (identifier: O76075-4) The sequence of this isoform differs from the canonical sequence as follows: 81-103: YVSDIRRFLSAFHEPQVGLIQAA → WFCHVSQDSLTLLGSSCPPALVS 104-338: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 338 | 338 | DNA fragmentation factor subunit beta | PRO_0000144713 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Domain | 4 – 80 | 77 | CIDE-N | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 81 – 116 | 36 | YVSDI…APQRQ → SVGVRARTKTRDTSSLSPGD CQALGNGGRCGQRLFL in isoform Gamma. | VSP_001081 | ||||||||||||||||||||
| Alternative sequence | 81 – 103 | 23 | YVSDI…LIQAA → WFCHVSQDSLTLLGSSCPPA LVS in isoform Delta. | VSP_001083 | ||||||||||||||||||||
| Alternative sequence | 104 – 338 | 235 | Missing in isoform Delta. | VSP_001084 | ||||||||||||||||||||
| Alternative sequence | 117 – 338 | 222 | Missing in isoform Gamma. | VSP_001082 | ||||||||||||||||||||
| Alternative sequence | 262 – 338 | 77 | IEKKR…VRKRQ → DGVLLCGPG in isoform Beta. | VSP_001080 | ||||||||||||||||||||
| Natural variant | 196 | 1 | R → K. Ref.10 Corresponds to variant rs12738235 [ dbSNP | Ensembl ]. | VAR_009305 | ||||||||||||||||||||
| Natural variant | 277 | 1 | K → R. Corresponds to variant rs12564400 [ dbSNP | Ensembl ]. | VAR_048737 | ||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Beta strand | 9 – 11 | 3 | ||||||||||||||||||||||
| Beta strand | 13 – 16 | 4 | ||||||||||||||||||||||
| Helix | 26 – 36 | 11 | ||||||||||||||||||||||
| Turn | 41 – 43 | 3 | ||||||||||||||||||||||
| Beta strand | 44 – 51 | 8 | ||||||||||||||||||||||
| Beta strand | 57 – 59 | 3 | ||||||||||||||||||||||
| Beta strand | 69 – 72 | 4 | ||||||||||||||||||||||
| Beta strand | 74 – 76 | 3 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The 40-kDa subunit of DNA fragmentation factor induces DNA fragmentation and chromatin condensation during apoptosis." Liu X., Li P., Widlak P., Zou H., Luo X., Garrard W.T., Wang X. Proc. Natl. Acad. Sci. U.S.A. 95:8461-8466(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA). |
| [2] | "Molecular cloning and characterization of human caspase-activated DNase." Mukae N., Enari M., Sakahira H., Fukuda Y., Inazawa J., Toh H., Nagata S. Proc. Natl. Acad. Sci. U.S.A. 95:9123-9128(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA). |
| [3] | "CPAN, a human nuclease regulated by the caspase-sensitive inhibitor DFF45." Halenbeck R., MacDonald H., Roulston A., Chen T.T., Conroy L., Williams L.T. Curr. Biol. 8:537-540(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA). Tissue: Pancreas. |
| [4] | "DFF40 delta." Nakagawara A., Takahashi M., Takada N., Kawamoto T. Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BETA; GAMMA AND DELTA). Tissue: Fetal brain. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). Tissue: Lung. |
| [8] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [9] | "Histone H1 subtype preferences of DFF40 and possible nuclear localization of DFF40/45 in normal and trichostatin A-treated NB4 leukemic cells." Ninios Y.P., Sekeri-Pataryas K.E., Sourlingas T.G. Apoptosis 15:128-138(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HIST1H1A. |
| [10] | "Structure and mutation analysis of the gene encoding DNA fragmentation factor 40 (caspase-activated nuclease), a candidate neuroblastoma tumour suppressor gene." Judson H., van Roy N., Strain L., Vandesompele J., Van Gele M., Speleman F., Bonthron D.T. Hum. Genet. 106:406-413(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LYS-196. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF064019 mRNA. Translation: AAC39920.1. AB013918 mRNA. Translation: BAA32250.1. AF039210 mRNA. Translation: AAC39709.1. AB028911 mRNA. Translation: BAB40447.1. AB028912 mRNA. Translation: BAB40448.1. AB028913 mRNA. Translation: BAB40449.1. AK290877 mRNA. Translation: BAF83566.1. AL691523 Genomic DNA. Translation: CAI17371.1. BC048797 mRNA. Translation: AAH48797.1. | ||||||||||||
| IPI | IPI00008794. IPI00179341. IPI00218518. IPI00883793. | ||||||||||||
| RefSeq | NP_004393.1. NM_004402.2. | ||||||||||||
| UniGene | Hs.133089. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O76075. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O76075. 5 interactions. | ||||||||||||
| STRING | 9606.ENSP00000367454. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O76075. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O76075. | ||||||||||||
| PRIDE | O76075. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000338895; ENSP00000339524; ENSG00000169598. ENST00000339350; ENSP00000343218; ENSG00000169598. ENST00000378209; ENSP00000367454; ENSG00000169598. ENST00000378212; ENSP00000367457; ENSG00000169598. ENST00000491998; ENSP00000436775; ENSG00000169598. | ||||||||||||
| GeneID | 1677. | ||||||||||||
| KEGG | hsa:1677. | ||||||||||||
| UCSC | uc001alc.3. human. uc009vlo.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 1677. | ||||||||||||
| GeneCards | GC01P003797. | ||||||||||||
| HGNC | HGNC:2773. DFFB. | ||||||||||||
| HPA | CAB004328. | ||||||||||||
| MIM | 601883. gene. | ||||||||||||
| neXtProt | NX_O76075. | ||||||||||||
| PharmGKB | PA27255. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG68641. | ||||||||||||
| HOGENOM | HOG000006502. | ||||||||||||
| HOVERGEN | HBG003828. | ||||||||||||
| InParanoid | O76075. | ||||||||||||
| KO | K02311. | ||||||||||||
| OMA | FLSVFQE. | ||||||||||||
| OrthoDB | EOG41RPV9. | ||||||||||||
| PhylomeDB | O76075. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. faspathway. FAS signaling pathway (CD95). hivnefpathway. HIV-1 Nef: Negative effector of Fas and TNF-alpha. | ||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O76075. | ||||||||||||
| Bgee | O76075. | ||||||||||||
| CleanEx | HS_CAD. HS_DFFB. | ||||||||||||
| Genevestigator | O76075. | ||||||||||||
| GermOnline | ENSG00000169598. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR015311. Apoptosis_DFF40. IPR003508. CAD. [Graphical view] | ||||||||||||
| Pfam | PF02017. CIDE-N. 1 hit. PF09230. DFF40. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS51135. CIDE_N. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | O76075. | ||||||||||||
| GenomeRNAi | 1677. | ||||||||||||
| NextBio | 6902. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | DFFB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O76075 Secondary accession number(s): O60521 Q9BYI6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
