O76054 (S14L2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SEC14-like protein 2 Alternative name(s): Alpha-tocopherol-associated protein Short name=TAP Short name=hTAP Squalene transfer protein Supernatant protein factor Short name=SPF | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 403 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Carrier protein. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds with high affinity to alpha-tocopherol. Also binds with a weaker affinity to other tocopherols and to tocotrienols. May have a transcriptional activatory activity via its association with alpha-tocopherol. Probably recognizes and binds some squalene structure, suggesting that it may regulate cholesterol biosynthesis by increasing the transfer of squalene to a metabolic active pool in the cell. |
| Subunit structure | Monomer By similarity. |
| Subcellular location | Cytoplasm. Nucleus. Note: Cytoplasmic in absence of alpha-tocopherol, and nuclear in presence of alpha-tocopherol. |
| Tissue specificity | Widely expressed. Strong expression in liver, brain and prostate. Ref.1 |
| Developmental stage | Low expression in fetal tissues. |
| Sequence similarities | Contains 1 CRAL-TRIO domain. Contains 1 GOLD domain. |
| Sequence caution | The sequence BAA86500.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O76054-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O76054-4) The sequence of this isoform differs from the canonical sequence as follows: 361-403: YVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK → CKYLCLGNALKPHVQLSACEVPLPPWIFGSEC | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 403 | 403 | SEC14-like protein 2 | PRO_0000210755 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 76 – 249 | 174 | CRAL-TRIO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 275 – 383 | 109 | GOLD | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 361 – 403 | 43 | YVLRF…AGTPK → CKYLCLGNALKPHVQLSACE VPLPPWIFGSEC in isoform 2. | VSP_042021 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 11 | 1 | R → K. Ref.7 Corresponds to variant rs757660 [ dbSNP | Ensembl ]. | VAR_024626 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 36 | 1 | Y → H Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 10 – 22 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 24 – 29 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 35 – 44 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 45 – 47 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 49 – 66 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 68 – 73 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 78 – 83 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 86 – 91 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 97 – 102 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 108 – 114 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 117 – 142 | 26 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 149 – 154 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 160 – 163 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 165 – 181 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 186 – 193 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 198 – 205 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 206 – 208 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 211 – 215 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 217 – 219 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 224 – 228 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 229 – 231 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 234 – 236 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 239 – 241 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 243 – 245 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 255 – 257 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 266 – 268 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 279 – 284 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 289 – 296 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 301 – 312 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 314 – 320 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 330 – 332 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 333 – 342 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 344 – 346 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 349 – 355 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 359 – 366 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 374 – 384 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 388 – 396 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel human tocopherol-associated protein: cloning, in vitro expression, and characterization." Zimmer S., Stocker A., Sarbolouki M.N., Spycher S.E., Sassoon J., Azzi A. J. Biol. Chem. 275:25672-25680(2000) [PubMed: 10829015] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, CHARACTERIZATION. |
| [2] | "Tocopherol-associated protein is a ligand-dependent transcriptional activator." Yamauchi J., Iwamoto T., Kida S., Masushige S., Yamada K., Esashi T. Biochem. Biophys. Res. Commun. 285:295-299(2001) [PubMed: 11444841] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION. Tissue: Liver. |
| [3] | "Supernatant protein factor, which stimulates the conversion of squalene to lanosterol, is a cytosolic squalene transfer protein and enhances cholesterol biosynthesis." Shibata N., Arita M., Misaki Y., Dohmae N., Takio K., Ono T., Inoue K., Arai H. Proc. Natl. Acad. Sci. U.S.A. 98:2244-2249(2001) [PubMed: 11226224] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION. Tissue: Liver. |
| [4] | "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain." Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O. DNA Res. 6:329-336(1999) [PubMed: 10574461] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | Ohara O., Nagase T., Kikuno R. Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [6] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed: 15461802] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LYS-11. Tissue: Kidney. |
| [8] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed: 10591208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [10] | "Crystal structure of the human supernatant protein factor." Stocker A., Tomizaki T., Schulze-Briese C., Baumann U. Structure 10:1533-1540(2002) [PubMed: 12429094] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AL096881 mRNA. Translation: CAB51405.1. AB033012 mRNA. Translation: BAA86500.2. Different initiation. CR456571 mRNA. Translation: CAG30457.1. AK223587 mRNA. Translation: BAD97307.1. AC004832 Genomic DNA. Translation: AAF19256.1. BC058915 mRNA. Translation: AAH58915.1. | ||||||||||||||||||
| IPI | IPI00018314. | ||||||||||||||||||
| PIR | JC7708. | ||||||||||||||||||
| RefSeq | NP_001191133.1. NM_001204204.1. NP_036561.1. NM_012429.3. NP_203740.1. NM_033382.2. | ||||||||||||||||||
| UniGene | Hs.335614. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | O76054. | ||||||||||||||||||
| SMR | O76054. Positions 1-397. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| STRING | O76054. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | O76054. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PeptideAtlas | O76054. | ||||||||||||||||||
| PRIDE | O76054. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000312932; ENSP00000316203; ENSG00000100003. | ||||||||||||||||||
| GeneID | 23541. | ||||||||||||||||||
| KEGG | hsa:23541. | ||||||||||||||||||
| UCSC | uc003ahr.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 23541. | ||||||||||||||||||
| GeneCards | GC22P030792. | ||||||||||||||||||
| H-InvDB | HIX0016371. | ||||||||||||||||||
| HGNC | HGNC:10699. SEC14L2. | ||||||||||||||||||
| MIM | 607558. gene. | ||||||||||||||||||
| neXtProt | NX_O76054. | ||||||||||||||||||
| PharmGKB | PA35622. | ||||||||||||||||||
| HUGE | Search... Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG04503. | ||||||||||||||||||
| GeneTree | ENSGT00550000074580. | ||||||||||||||||||
| HOGENOM | HBG506277. | ||||||||||||||||||
| HOVERGEN | HBG055336. | ||||||||||||||||||
| InParanoid | O76054. | ||||||||||||||||||
| OMA | NFTVEVL. | ||||||||||||||||||
| OrthoDB | EOG4QC15C. | ||||||||||||||||||
| PhylomeDB | O76054. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O76054. | ||||||||||||||||||
| Bgee | O76054. | ||||||||||||||||||
| CleanEx | HS_SEC14L2. | ||||||||||||||||||
| Genevestigator | O76054. | ||||||||||||||||||
| GermOnline | ENSG00000100003. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR001071. CRAL-bd_toc_tran. IPR001251. CRAL-TRIO_dom. IPR011074. CRAL/TRIO_N_dom. IPR009038. GOLD. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:3.40.525.10. CRAL_bd_TRIO_C. 1 hit. G3DSA:1.10.8.20. G3DSA:1.10.8.20. 1 hit. | ||||||||||||||||||
| Pfam | PF00650. CRAL_TRIO. 1 hit. PF03765. CRAL_TRIO_N. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00180. CRETINALDHBP. | ||||||||||||||||||
| SMART | SM01100. CRAL_TRIO_N. 1 hit. SM00516. SEC14. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF52087. CRAL_TRIO_C. 1 hit. SSF101576. GOLD. 1 hit. SSF46938. Sec14p_like_N. 1 hit. | ||||||||||||||||||
| PROSITE | PS50191. CRAL_TRIO. 1 hit. PS50866. GOLD. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| DrugBank | DB00163. Vitamin E. | ||||||||||||||||||
| NextBio | 46048. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | S14L2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O76054 Secondary accession number(s): Q53EQ2, Q6PD61, Q9ULN4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with