Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SEC14-like protein 2

Gene

SEC14L2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Carrier protein. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds with high affinity to alpha-tocopherol. Also binds with a weaker affinity to other tocopherols and to tocotrienols. May have a transcriptional activatory activity via its association with alpha-tocopherol. Probably recognizes and binds some squalene structure, suggesting that it may regulate cholesterol biosynthesis by increasing the transfer of squalene to a metabolic active pool in the cell.

GO - Molecular functioni

  • phospholipid binding Source: UniProtKB
  • transporter activity Source: InterPro
  • vitamin E binding Source: UniProtKB

GO - Biological processi

  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • regulation of cholesterol biosynthetic process Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation, Transport

Keywords - Ligandi

Lipid-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100003-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
SEC14-like protein 2
Alternative name(s):
Alpha-tocopherol-associated protein
Short name:
TAP
Short name:
hTAP
Squalene transfer protein
Supernatant protein factor
Short name:
SPF
Gene namesi
Name:SEC14L2
Synonyms:C22orf6, KIAA1186, KIAA1658
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:10699. SEC14L2.

Subcellular locationi

  • Cytoplasm
  • Nucleus

  • Note: Cytoplasmic in absence of alpha-tocopherol, and nuclear in presence of alpha-tocopherol.

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • integral component of membrane Source: InterPro
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi23541.
OpenTargetsiENSG00000100003.
PharmGKBiPA35622.

Chemistry databases

DrugBankiDB00163. Vitamin E.

Polymorphism and mutation databases

BioMutaiSEC14L2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002107551 – 403SEC14-like protein 2Add BLAST403

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei51N6-succinyllysineBy similarity1
Modified residuei253N6-succinyllysineBy similarity1
Modified residuei257N6-succinyllysineBy similarity1
Modified residuei393N6-succinyllysineBy similarity1

Proteomic databases

EPDiO76054.
MaxQBiO76054.
PaxDbiO76054.
PeptideAtlasiO76054.
PRIDEiO76054.

PTM databases

iPTMnetiO76054.
PhosphoSitePlusiO76054.
SwissPalmiO76054.

Expressioni

Tissue specificityi

Widely expressed. Strong expression in liver, brain and prostate.1 Publication

Developmental stagei

Low expression in fetal tissues.

Gene expression databases

BgeeiENSG00000100003.
CleanExiHS_SEC14L2.
ExpressionAtlasiO76054. baseline and differential.
GenevisibleiO76054. HS.

Organism-specific databases

HPAiHPA064466.

Interactioni

Subunit structurei

Monomer.By similarity

Protein-protein interaction databases

BioGridi117085. 1 interactor.
IntActiO76054. 1 interactor.
MINTiMINT-3002196.
STRINGi9606.ENSP00000316203.

Structurei

Secondary structure

1403
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni5 – 7Combined sources3
Helixi10 – 23Combined sources14
Turni24 – 26Combined sources3
Helixi27 – 29Combined sources3
Helixi35 – 44Combined sources10
Turni45 – 47Combined sources3
Helixi49 – 65Combined sources17
Helixi68 – 73Combined sources6
Helixi78 – 83Combined sources6
Beta strandi86 – 91Combined sources6
Beta strandi97 – 102Combined sources6
Helixi108 – 114Combined sources7
Helixi117 – 142Combined sources26
Beta strandi149 – 154Combined sources6
Helixi160 – 163Combined sources4
Helixi165 – 181Combined sources17
Beta strandi186 – 193Combined sources8
Helixi198 – 205Combined sources8
Helixi206 – 208Combined sources3
Helixi211 – 215Combined sources5
Beta strandi217 – 219Combined sources3
Helixi224 – 231Combined sources8
Helixi234 – 236Combined sources3
Helixi239 – 241Combined sources3
Beta strandi243 – 245Combined sources3
Turni255 – 257Combined sources3
Helixi266 – 268Combined sources3
Beta strandi279 – 284Combined sources6
Beta strandi289 – 296Combined sources8
Beta strandi302 – 312Combined sources11
Beta strandi314 – 320Combined sources7
Beta strandi323 – 326Combined sources4
Helixi330 – 332Combined sources3
Beta strandi333 – 342Combined sources10
Turni344 – 346Combined sources3
Beta strandi349 – 354Combined sources6
Beta strandi359 – 366Combined sources8
Beta strandi374 – 384Combined sources11
Helixi388 – 395Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1O6UX-ray2.05A/C/E1-403[»]
1OLMX-ray1.95A/C/E1-403[»]
4OMJX-ray1.60A/B1-275[»]
4OMKX-ray1.75A/B1-275[»]
ProteinModelPortaliO76054.
SMRiO76054.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO76054.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini76 – 249CRAL-TRIOPROSITE-ProRule annotationAdd BLAST174
Domaini275 – 383GOLDPROSITE-ProRule annotationAdd BLAST109

Sequence similaritiesi

Contains 1 CRAL-TRIO domain.PROSITE-ProRule annotation
Contains 1 GOLD domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1471. Eukaryota.
ENOG410XRSQ. LUCA.
GeneTreeiENSGT00550000074580.
HOGENOMiHOG000232201.
HOVERGENiHBG055336.
InParanoidiO76054.
OMAiSPIWYDI.
OrthoDBiEOG091G0MI9.
PhylomeDBiO76054.
TreeFamiTF313988.

Family and domain databases

Gene3Di3.40.525.10. 1 hit.
InterProiIPR001071. CRAL-bd_toc_tran.
IPR001251. CRAL-TRIO_dom.
IPR011074. CRAL/TRIO_N_dom.
IPR009038. GOLD_dom.
[Graphical view]
PfamiPF00650. CRAL_TRIO. 1 hit.
[Graphical view]
PRINTSiPR00180. CRETINALDHBP.
SMARTiSM01100. CRAL_TRIO_N. 1 hit.
SM00516. SEC14. 1 hit.
[Graphical view]
SUPFAMiSSF101576. SSF101576. 1 hit.
SSF46938. SSF46938. 1 hit.
SSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
PS50866. GOLD. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O76054-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGRVGDLSP RQKEALAKFR ENVQDVLPAL PNPDDYFLLR WLRARSFDLQ
60 70 80 90 100
KSEAMLRKHV EFRKQKDIDN IISWQPPEVI QQYLSGGMCG YDLDGCPVWY
110 120 130 140 150
DIIGPLDAKG LLFSASKQDL LRTKMRECEL LLQECAHQTT KLGRKVETIT
160 170 180 190 200
IIYDCEGLGL KHLWKPAVEA YGEFLCMFEE NYPETLKRLF VVKAPKLFPV
210 220 230 240 250
AYNLIKPFLS EDTRKKIMVL GANWKEVLLK HISPDQVPVE YGGTMTDPDG
260 270 280 290 300
NPKCKSKINY GGDIPRKYYV RDQVKQQYEH SVQISRGSSH QVEYEILFPG
310 320 330 340 350
CVLRWQFMSD GADVGFGIFL KTKMGERQRA GEMTEVLPNQ RYNSHLVPED
360 370 380 390 400
GTLTCSDPGI YVLRFDNTYS FIHAKKVNFT VEVLLPDKAS EEKMKQLGAG

TPK
Length:403
Mass (Da):46,145
Last modified:November 1, 1998 - v1
Checksum:iD846747EC8D1513E
GO
Isoform 2 (identifier: O76054-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     361-403: YVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK → CKYLCLGNALKPHVQLSACEVPLPPWIFGSEC

Note: No experimental confirmation available.
Show »
Length:392
Mass (Da):44,748
Checksum:i11A833345968FE5A
GO
Isoform 3 (identifier: O76054-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-140: Missing.

Note: No experimental confirmation available.
Show »
Length:320
Mass (Da):36,636
Checksum:i64CCC92D4A8149C7
GO

Sequence cautioni

The sequence BAA86500 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti36Y → H (PubMed:11444841).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02462611R → K.2 PublicationsCorresponds to variant rs757660dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04588058 – 140Missing in isoform 3. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_042021361 – 403YVLRF…AGTPK → CKYLCLGNALKPHVQLSACE VPLPPWIFGSEC in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL096881 mRNA. Translation: CAB51405.1.
AB033012 mRNA. Translation: BAA86500.2. Different initiation.
CR456571 mRNA. Translation: CAG30457.1.
AK303751 mRNA. Translation: BAH14037.1.
AK223587 mRNA. Translation: BAD97307.1.
AC004832 Genomic DNA. Translation: AAF19256.1.
BC058915 mRNA. Translation: AAH58915.1.
CCDSiCCDS13876.1. [O76054-1]
CCDS46685.1. [O76054-4]
CCDS56228.1. [O76054-5]
PIRiJC7708.
RefSeqiNP_001191133.1. NM_001204204.2. [O76054-5]
NP_036561.1. NM_012429.4. [O76054-1]
NP_203740.1. NM_033382.2. [O76054-4]
UniGeneiHs.335614.

Genome annotation databases

EnsembliENST00000402592; ENSP00000383882; ENSG00000100003. [O76054-5]
ENST00000405717; ENSP00000385186; ENSG00000100003. [O76054-4]
ENST00000615189; ENSP00000478755; ENSG00000100003. [O76054-1]
GeneIDi23541.
KEGGihsa:23541.
UCSCiuc003ahq.5. human. [O76054-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL096881 mRNA. Translation: CAB51405.1.
AB033012 mRNA. Translation: BAA86500.2. Different initiation.
CR456571 mRNA. Translation: CAG30457.1.
AK303751 mRNA. Translation: BAH14037.1.
AK223587 mRNA. Translation: BAD97307.1.
AC004832 Genomic DNA. Translation: AAF19256.1.
BC058915 mRNA. Translation: AAH58915.1.
CCDSiCCDS13876.1. [O76054-1]
CCDS46685.1. [O76054-4]
CCDS56228.1. [O76054-5]
PIRiJC7708.
RefSeqiNP_001191133.1. NM_001204204.2. [O76054-5]
NP_036561.1. NM_012429.4. [O76054-1]
NP_203740.1. NM_033382.2. [O76054-4]
UniGeneiHs.335614.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1O6UX-ray2.05A/C/E1-403[»]
1OLMX-ray1.95A/C/E1-403[»]
4OMJX-ray1.60A/B1-275[»]
4OMKX-ray1.75A/B1-275[»]
ProteinModelPortaliO76054.
SMRiO76054.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117085. 1 interactor.
IntActiO76054. 1 interactor.
MINTiMINT-3002196.
STRINGi9606.ENSP00000316203.

Chemistry databases

DrugBankiDB00163. Vitamin E.

PTM databases

iPTMnetiO76054.
PhosphoSitePlusiO76054.
SwissPalmiO76054.

Polymorphism and mutation databases

BioMutaiSEC14L2.

Proteomic databases

EPDiO76054.
MaxQBiO76054.
PaxDbiO76054.
PeptideAtlasiO76054.
PRIDEiO76054.

Protocols and materials databases

DNASUi23541.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000402592; ENSP00000383882; ENSG00000100003. [O76054-5]
ENST00000405717; ENSP00000385186; ENSG00000100003. [O76054-4]
ENST00000615189; ENSP00000478755; ENSG00000100003. [O76054-1]
GeneIDi23541.
KEGGihsa:23541.
UCSCiuc003ahq.5. human. [O76054-1]

Organism-specific databases

CTDi23541.
DisGeNETi23541.
GeneCardsiSEC14L2.
HGNCiHGNC:10699. SEC14L2.
HPAiHPA064466.
MIMi607558. gene.
neXtProtiNX_O76054.
OpenTargetsiENSG00000100003.
PharmGKBiPA35622.
HUGEiSearch...
Search...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1471. Eukaryota.
ENOG410XRSQ. LUCA.
GeneTreeiENSGT00550000074580.
HOGENOMiHOG000232201.
HOVERGENiHBG055336.
InParanoidiO76054.
OMAiSPIWYDI.
OrthoDBiEOG091G0MI9.
PhylomeDBiO76054.
TreeFamiTF313988.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100003-MONOMER.

Miscellaneous databases

ChiTaRSiSEC14L2. human.
EvolutionaryTraceiO76054.
GeneWikiiSEC14L2.
GenomeRNAii23541.
PROiO76054.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100003.
CleanExiHS_SEC14L2.
ExpressionAtlasiO76054. baseline and differential.
GenevisibleiO76054. HS.

Family and domain databases

Gene3Di3.40.525.10. 1 hit.
InterProiIPR001071. CRAL-bd_toc_tran.
IPR001251. CRAL-TRIO_dom.
IPR011074. CRAL/TRIO_N_dom.
IPR009038. GOLD_dom.
[Graphical view]
PfamiPF00650. CRAL_TRIO. 1 hit.
[Graphical view]
PRINTSiPR00180. CRETINALDHBP.
SMARTiSM01100. CRAL_TRIO_N. 1 hit.
SM00516. SEC14. 1 hit.
[Graphical view]
SUPFAMiSSF101576. SSF101576. 1 hit.
SSF46938. SSF46938. 1 hit.
SSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
PS50866. GOLD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiS14L2_HUMAN
AccessioniPrimary (citable) accession number: O76054
Secondary accession number(s): B7Z8Q1
, F5H3U4, Q53EQ2, Q6PD61, Q9ULN4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 20, 2002
Last sequence update: November 1, 1998
Last modified: November 2, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.