Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O76013

- KRT36_HUMAN

UniProt

O76013 - KRT36_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Keratin, type I cuticular Ha6

Gene

KRT36

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei342 – 3421Stutter

GO - Molecular functioni

  1. structural constituent of epidermis Source: UniProtKB

GO - Biological processi

  1. regulation of keratinocyte differentiation Source: Ensembl
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Keratin, type I cuticular Ha6
Alternative name(s):
Hair keratin, type I Ha6
Keratin-36
Short name:
K36
Gene namesi
Name:KRT36
Synonyms:HHA6, HKA6, KRTHA6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:6454. KRT36.

Subcellular locationi

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProtKB
  2. intermediate filament Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Intermediate filament, Keratin

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30243.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 467467Keratin, type I cuticular Ha6PRO_0000063693Add
BLAST

Proteomic databases

MaxQBiO76013.
PaxDbiO76013.
PeptideAtlasiO76013.
PRIDEiO76013.

PTM databases

PhosphoSiteiO76013.

Expressioni

Tissue specificityi

Expressed in the hair follicles.1 Publication

Gene expression databases

BgeeiO76013.
CleanExiHS_KRT36.
GenevestigatoriO76013.

Organism-specific databases

HPAiHPA021426.

Interactioni

Subunit structurei

Heterotetramer of two type I and two type II keratins.By similarity

Protein-protein interaction databases

BioGridi114236. 8 interactions.
IntActiO76013. 7 interactions.
MINTiMINT-6769057.
STRINGi9606.ENSP00000329165.

Structurei

3D structure databases

ProteinModelPortaliO76013.
SMRiO76013. Positions 143-241, 311-399.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 9393HeadAdd
BLAST
Regioni94 – 400307RodAdd
BLAST
Regioni94 – 12835Coil 1AAdd
BLAST
Regioni129 – 13911Linker 1Add
BLAST
Regioni140 – 240101Coil 1BAdd
BLAST
Regioni241 – 25616Linker 12Add
BLAST
Regioni257 – 400144Coil 2Add
BLAST
Regioni401 – 46767TailAdd
BLAST

Sequence similaritiesi

Belongs to the intermediate filament family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG145287.
GeneTreeiENSGT00760000118808.
HOGENOMiHOG000230975.
HOVERGENiHBG013015.
InParanoidiO76013.
KOiK07604.
OMAiVGTQIRT.
OrthoDBiEOG7FV3Q8.
PhylomeDBiO76013.
TreeFamiTF332742.

Family and domain databases

InterProiIPR001664. IF.
IPR018039. Intermediate_filament_CS.
IPR002957. Keratin_I.
IPR009053. Prefoldin.
[Graphical view]
PANTHERiPTHR23239. PTHR23239. 1 hit.
PfamiPF00038. Filament. 1 hit.
[Graphical view]
PRINTSiPR01248. TYPE1KERATIN.
SUPFAMiSSF46579. SSF46579. 1 hit.
PROSITEiPS00226. IF. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O76013-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATQTCTPTF STGSIKGLCG TAGGISRVSS IRSVGSCRVP SLAGAAGYIS
60 70 80 90 100
SARSGLSGLG SCLPGSYLSS ECHTSGFVGS GGWFCEGSFN GSEKETMQFL
110 120 130 140 150
NDRLANYLEK VRQLERENAE LESRIQEWYE FQIPYICPDY QSYFKTIEDF
160 170 180 190 200
QQKILLTKSE NARLVLQIDN AKLAADDFRT KYETELSLRQ LVEADINGLR
210 220 230 240 250
RILDELTLCK ADLEAQVESL KEELMCLKKN HEEEVSVLRC QLGDRLNVEV
260 270 280 290 300
DAAPPVDLNK ILEDMRCQYE ALVENNRRDV EAWFNTQTEE LNQQVVSSSE
310 320 330 340 350
QLQCCQTEII ELRRTVNALE IELQAQHSMR NSLESTLAET EARYSSQLAQ
360 370 380 390 400
MQCLISNVEA QLSEIRCDLE RQNQEYQVLL DVKARLEGEI ATYRHLLEGE
410 420 430 440 450
DCKLPPQPCA TACKPVIRVP SVPPVPCVPS VPCTPAPQVG TQIRTITEEI
460
RDGKVISSRE HVQSRPL
Length:467
Mass (Da):52,247
Last modified:November 1, 1998 - v1
Checksum:i492B3B2DE3BCAECD
GO
Isoform 2 (identifier: O76013-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSA → ML

Note: No experimental confirmation available.

Show »
Length:417
Mass (Da):47,485
Checksum:iD27B5052EDC12A3B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti119 – 1191A → V.
Corresponds to variant rs8082683 [ dbSNP | Ensembl ].
VAR_024490
Natural varianti126 – 1261Q → R.
Corresponds to variant rs8069943 [ dbSNP | Ensembl ].
VAR_024491
Natural varianti179 – 1791R → Q.
Corresponds to variant rs9675246 [ dbSNP | Ensembl ].
VAR_049792
Natural varianti277 – 2771R → C.
Corresponds to variant rs9904102 [ dbSNP | Ensembl ].
VAR_049793
Natural varianti315 – 3151T → M.
Corresponds to variant rs2301354 [ dbSNP | Ensembl ].
VAR_020306
Natural varianti357 – 3571N → T.
Corresponds to variant rs11657323 [ dbSNP | Ensembl ].
VAR_049794

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5252MATQT…YISSA → ML in isoform 2. 1 PublicationVSP_036403Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16792 Genomic DNA. Translation: CAA76388.1.
CH471152 Genomic DNA. Translation: EAW60738.1.
BC043581 mRNA. Translation: AAH43581.1.
CCDSiCCDS11395.1. [O76013-1]
RefSeqiNP_003762.1. NM_003771.4. [O76013-1]
XP_005257819.1. XM_005257762.2. [O76013-2]
UniGeneiHs.248189.

Genome annotation databases

EnsembliENST00000328119; ENSP00000329165; ENSG00000126337. [O76013-1]
ENST00000393986; ENSP00000377555; ENSG00000126337. [O76013-2]
GeneIDi8689.
KEGGihsa:8689.
UCSCiuc002hwt.3. human. [O76013-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16792 Genomic DNA. Translation: CAA76388.1 .
CH471152 Genomic DNA. Translation: EAW60738.1 .
BC043581 mRNA. Translation: AAH43581.1 .
CCDSi CCDS11395.1. [O76013-1 ]
RefSeqi NP_003762.1. NM_003771.4. [O76013-1 ]
XP_005257819.1. XM_005257762.2. [O76013-2 ]
UniGenei Hs.248189.

3D structure databases

ProteinModelPortali O76013.
SMRi O76013. Positions 143-241, 311-399.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114236. 8 interactions.
IntActi O76013. 7 interactions.
MINTi MINT-6769057.
STRINGi 9606.ENSP00000329165.

PTM databases

PhosphoSitei O76013.

Proteomic databases

MaxQBi O76013.
PaxDbi O76013.
PeptideAtlasi O76013.
PRIDEi O76013.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000328119 ; ENSP00000329165 ; ENSG00000126337 . [O76013-1 ]
ENST00000393986 ; ENSP00000377555 ; ENSG00000126337 . [O76013-2 ]
GeneIDi 8689.
KEGGi hsa:8689.
UCSCi uc002hwt.3. human. [O76013-1 ]

Organism-specific databases

CTDi 8689.
GeneCardsi GC17M039642.
H-InvDB HIX0027332.
HGNCi HGNC:6454. KRT36.
HPAi HPA021426.
MIMi 604540. gene.
neXtProti NX_O76013.
PharmGKBi PA30243.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG145287.
GeneTreei ENSGT00760000118808.
HOGENOMi HOG000230975.
HOVERGENi HBG013015.
InParanoidi O76013.
KOi K07604.
OMAi VGTQIRT.
OrthoDBi EOG7FV3Q8.
PhylomeDBi O76013.
TreeFami TF332742.

Miscellaneous databases

GeneWikii KRT36.
GenomeRNAii 8689.
NextBioi 32587.
PROi O76013.
SOURCEi Search...

Gene expression databases

Bgeei O76013.
CleanExi HS_KRT36.
Genevestigatori O76013.

Family and domain databases

InterProi IPR001664. IF.
IPR018039. Intermediate_filament_CS.
IPR002957. Keratin_I.
IPR009053. Prefoldin.
[Graphical view ]
PANTHERi PTHR23239. PTHR23239. 1 hit.
Pfami PF00038. Filament. 1 hit.
[Graphical view ]
PRINTSi PR01248. TYPE1KERATIN.
SUPFAMi SSF46579. SSF46579. 1 hit.
PROSITEi PS00226. IF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of a 190-kilobase pair domain of human type I hair keratin genes."
    Rogers M.A., Winter H., Wolf C., Heck M., Schweizer J.
    J. Biol. Chem. 273:26683-26691(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1), TISSUE SPECIFICITY.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

Entry informationi

Entry nameiKRT36_HUMAN
AccessioniPrimary (citable) accession number: O76013
Secondary accession number(s): Q86XG4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: October 29, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

There are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic).

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3