Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O76013

- KRT36_HUMAN

UniProt

O76013 - KRT36_HUMAN

Protein

Keratin, type I cuticular Ha6

Gene

KRT36

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 116 (01 Oct 2014)
      Sequence version 1 (01 Nov 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei342 – 3421Stutter

    GO - Molecular functioni

    1. structural constituent of epidermis Source: UniProtKB

    GO - Biological processi

    1. regulation of keratinocyte differentiation Source: Ensembl

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Keratin, type I cuticular Ha6
    Alternative name(s):
    Hair keratin, type I Ha6
    Keratin-36
    Short name:
    K36
    Gene namesi
    Name:KRT36
    Synonyms:HHA6, HKA6, KRTHA6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:6454. KRT36.

    Subcellular locationi

    GO - Cellular componenti

    1. intermediate filament Source: UniProtKB-KW

    Keywords - Cellular componenti

    Intermediate filament, Keratin

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30243.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 467467Keratin, type I cuticular Ha6PRO_0000063693Add
    BLAST

    Proteomic databases

    MaxQBiO76013.
    PaxDbiO76013.
    PeptideAtlasiO76013.
    PRIDEiO76013.

    PTM databases

    PhosphoSiteiO76013.

    Expressioni

    Tissue specificityi

    Expressed in the hair follicles.1 Publication

    Gene expression databases

    BgeeiO76013.
    CleanExiHS_KRT36.
    GenevestigatoriO76013.

    Organism-specific databases

    HPAiHPA021426.

    Interactioni

    Subunit structurei

    Heterotetramer of two type I and two type II keratins.By similarity

    Protein-protein interaction databases

    BioGridi114236. 8 interactions.
    IntActiO76013. 7 interactions.
    MINTiMINT-6769057.
    STRINGi9606.ENSP00000329165.

    Structurei

    3D structure databases

    ProteinModelPortaliO76013.
    SMRiO76013. Positions 96-128, 143-241, 311-399.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 9393HeadAdd
    BLAST
    Regioni94 – 400307RodAdd
    BLAST
    Regioni94 – 12835Coil 1AAdd
    BLAST
    Regioni129 – 13911Linker 1Add
    BLAST
    Regioni140 – 240101Coil 1BAdd
    BLAST
    Regioni241 – 25616Linker 12Add
    BLAST
    Regioni257 – 400144Coil 2Add
    BLAST
    Regioni401 – 46767TailAdd
    BLAST

    Sequence similaritiesi

    Belongs to the intermediate filament family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG145287.
    HOGENOMiHOG000230975.
    HOVERGENiHBG013015.
    InParanoidiO76013.
    KOiK07604.
    OMAiVGTQIRT.
    OrthoDBiEOG7FV3Q8.
    PhylomeDBiO76013.
    TreeFamiTF332742.

    Family and domain databases

    InterProiIPR001664. IF.
    IPR018039. Intermediate_filament_CS.
    IPR002957. Keratin_I.
    IPR009053. Prefoldin.
    [Graphical view]
    PANTHERiPTHR23239. PTHR23239. 1 hit.
    PfamiPF00038. Filament. 1 hit.
    [Graphical view]
    PRINTSiPR01248. TYPE1KERATIN.
    SUPFAMiSSF46579. SSF46579. 1 hit.
    PROSITEiPS00226. IF. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O76013-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MATQTCTPTF STGSIKGLCG TAGGISRVSS IRSVGSCRVP SLAGAAGYIS    50
    SARSGLSGLG SCLPGSYLSS ECHTSGFVGS GGWFCEGSFN GSEKETMQFL 100
    NDRLANYLEK VRQLERENAE LESRIQEWYE FQIPYICPDY QSYFKTIEDF 150
    QQKILLTKSE NARLVLQIDN AKLAADDFRT KYETELSLRQ LVEADINGLR 200
    RILDELTLCK ADLEAQVESL KEELMCLKKN HEEEVSVLRC QLGDRLNVEV 250
    DAAPPVDLNK ILEDMRCQYE ALVENNRRDV EAWFNTQTEE LNQQVVSSSE 300
    QLQCCQTEII ELRRTVNALE IELQAQHSMR NSLESTLAET EARYSSQLAQ 350
    MQCLISNVEA QLSEIRCDLE RQNQEYQVLL DVKARLEGEI ATYRHLLEGE 400
    DCKLPPQPCA TACKPVIRVP SVPPVPCVPS VPCTPAPQVG TQIRTITEEI 450
    RDGKVISSRE HVQSRPL 467
    Length:467
    Mass (Da):52,247
    Last modified:November 1, 1998 - v1
    Checksum:i492B3B2DE3BCAECD
    GO
    Isoform 2 (identifier: O76013-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-52: MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSA → ML

    Note: No experimental confirmation available.

    Show »
    Length:417
    Mass (Da):47,485
    Checksum:iD27B5052EDC12A3B
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti119 – 1191A → V.
    Corresponds to variant rs8082683 [ dbSNP | Ensembl ].
    VAR_024490
    Natural varianti126 – 1261Q → R.
    Corresponds to variant rs8069943 [ dbSNP | Ensembl ].
    VAR_024491
    Natural varianti179 – 1791R → Q.
    Corresponds to variant rs9675246 [ dbSNP | Ensembl ].
    VAR_049792
    Natural varianti277 – 2771R → C.
    Corresponds to variant rs9904102 [ dbSNP | Ensembl ].
    VAR_049793
    Natural varianti315 – 3151T → M.
    Corresponds to variant rs2301354 [ dbSNP | Ensembl ].
    VAR_020306
    Natural varianti357 – 3571N → T.
    Corresponds to variant rs11657323 [ dbSNP | Ensembl ].
    VAR_049794

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5252MATQT…YISSA → ML in isoform 2. 1 PublicationVSP_036403Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y16792 Genomic DNA. Translation: CAA76388.1.
    CH471152 Genomic DNA. Translation: EAW60738.1.
    BC043581 mRNA. Translation: AAH43581.1.
    CCDSiCCDS11395.1. [O76013-1]
    RefSeqiNP_003762.1. NM_003771.4. [O76013-1]
    XP_005257819.1. XM_005257762.2. [O76013-2]
    UniGeneiHs.248189.

    Genome annotation databases

    EnsembliENST00000328119; ENSP00000329165; ENSG00000126337. [O76013-1]
    ENST00000393986; ENSP00000377555; ENSG00000126337. [O76013-2]
    GeneIDi8689.
    KEGGihsa:8689.
    UCSCiuc002hwt.3. human. [O76013-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y16792 Genomic DNA. Translation: CAA76388.1 .
    CH471152 Genomic DNA. Translation: EAW60738.1 .
    BC043581 mRNA. Translation: AAH43581.1 .
    CCDSi CCDS11395.1. [O76013-1 ]
    RefSeqi NP_003762.1. NM_003771.4. [O76013-1 ]
    XP_005257819.1. XM_005257762.2. [O76013-2 ]
    UniGenei Hs.248189.

    3D structure databases

    ProteinModelPortali O76013.
    SMRi O76013. Positions 96-128, 143-241, 311-399.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114236. 8 interactions.
    IntActi O76013. 7 interactions.
    MINTi MINT-6769057.
    STRINGi 9606.ENSP00000329165.

    PTM databases

    PhosphoSitei O76013.

    Proteomic databases

    MaxQBi O76013.
    PaxDbi O76013.
    PeptideAtlasi O76013.
    PRIDEi O76013.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000328119 ; ENSP00000329165 ; ENSG00000126337 . [O76013-1 ]
    ENST00000393986 ; ENSP00000377555 ; ENSG00000126337 . [O76013-2 ]
    GeneIDi 8689.
    KEGGi hsa:8689.
    UCSCi uc002hwt.3. human. [O76013-1 ]

    Organism-specific databases

    CTDi 8689.
    GeneCardsi GC17M039642.
    H-InvDB HIX0027332.
    HGNCi HGNC:6454. KRT36.
    HPAi HPA021426.
    MIMi 604540. gene.
    neXtProti NX_O76013.
    PharmGKBi PA30243.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG145287.
    HOGENOMi HOG000230975.
    HOVERGENi HBG013015.
    InParanoidi O76013.
    KOi K07604.
    OMAi VGTQIRT.
    OrthoDBi EOG7FV3Q8.
    PhylomeDBi O76013.
    TreeFami TF332742.

    Miscellaneous databases

    GeneWikii KRT36.
    GenomeRNAii 8689.
    NextBioi 32587.
    PROi O76013.
    SOURCEi Search...

    Gene expression databases

    Bgeei O76013.
    CleanExi HS_KRT36.
    Genevestigatori O76013.

    Family and domain databases

    InterProi IPR001664. IF.
    IPR018039. Intermediate_filament_CS.
    IPR002957. Keratin_I.
    IPR009053. Prefoldin.
    [Graphical view ]
    PANTHERi PTHR23239. PTHR23239. 1 hit.
    Pfami PF00038. Filament. 1 hit.
    [Graphical view ]
    PRINTSi PR01248. TYPE1KERATIN.
    SUPFAMi SSF46579. SSF46579. 1 hit.
    PROSITEi PS00226. IF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of a 190-kilobase pair domain of human type I hair keratin genes."
      Rogers M.A., Winter H., Wolf C., Heck M., Schweizer J.
      J. Biol. Chem. 273:26683-26691(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1), TISSUE SPECIFICITY.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

    Entry informationi

    Entry nameiKRT36_HUMAN
    AccessioniPrimary (citable) accession number: O76013
    Secondary accession number(s): Q86XG4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: November 1, 1998
    Last modified: October 1, 2014
    This is version 116 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    There are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic).

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3