O76013 (KRT36_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Keratin, type I cuticular Ha6 Alternative name(s): Hair keratin, type I Ha6 Keratin-36 Short name=K36 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 467 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Heterotetramer of two type I and two type II keratins By similarity. |
| Tissue specificity | Expressed in the hair follicle. Ref.1 |
| Miscellaneous | There are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic). |
| Sequence similarities | Belongs to the intermediate filament family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Intermediate filament Keratin |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | intermediate filament Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | structural constituent of epidermis Non-traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O76013-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O76013-2) The sequence of this isoform differs from the canonical sequence as follows: 1-52: MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSA → ML | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 467 | 467 | Keratin, type I cuticular Ha6 | PRO_0000063693 | |||||
Regions | |||||||||
| Region | 1 – 93 | 93 | Head | ||||||
| Region | 94 – 400 | 307 | Rod | ||||||
| Region | 94 – 128 | 35 | Coil 1A | ||||||
| Region | 129 – 139 | 11 | Linker 1 | ||||||
| Region | 140 – 240 | 101 | Coil 1B | ||||||
| Region | 241 – 256 | 16 | Linker 12 | ||||||
| Region | 257 – 400 | 144 | Coil 2 | ||||||
| Region | 401 – 467 | 67 | Tail | ||||||
Sites | |||||||||
| Site | 342 | 1 | Stutter | ||||||
Amino acid modifications | |||||||||
| Modified residue | 315 | 1 | Phosphothreonine Ref.4 | ||||||
| Modified residue | 328 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 52 | 52 | MATQT…YISSA → ML in isoform 2. | VSP_036403 | |||||
| Natural variant | 119 | 1 | A → V. Corresponds to variant rs8082683 [ dbSNP | Ensembl ]. | VAR_024490 | |||||
| Natural variant | 126 | 1 | Q → R. Corresponds to variant rs8069943 [ dbSNP | Ensembl ]. | VAR_024491 | |||||
| Natural variant | 179 | 1 | R → Q. Corresponds to variant rs9675246 [ dbSNP | Ensembl ]. | VAR_049792 | |||||
| Natural variant | 277 | 1 | R → C. Corresponds to variant rs9904102 [ dbSNP | Ensembl ]. | VAR_049793 | |||||
| Natural variant | 315 | 1 | T → M. Corresponds to variant rs2301354 [ dbSNP | Ensembl ]. | VAR_020306 | |||||
| Natural variant | 357 | 1 | N → T. Corresponds to variant rs11657323 [ dbSNP | Ensembl ]. | VAR_049794 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of a 190-kilobase pair domain of human type I hair keratin genes." Rogers M.A., Winter H., Wolf C., Heck M., Schweizer J. J. Biol. Chem. 273:26683-26691(1998) [PubMed: 9756910] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [4] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-315 AND SER-328, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y16792 Genomic DNA. Translation: CAA76388.1. CH471152 Genomic DNA. Translation: EAW60738.1. BC043581 mRNA. Translation: AAH43581.1. |
| IPI | IPI00008692. IPI00795958. |
| RefSeq | NP_003762.1. NM_003771.4. |
| UniGene | Hs.248189. |
3D structure databases | |
| ProteinModelPortal | O76013. |
| SMR | O76013. Positions 90-128, 136-241, 256-399. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O76013. 7 interactions. |
| MINT | MINT-6769057. |
| STRING | O76013. |
PTM databases | |
| PhosphoSite | O76013. |
Proteomic databases | |
| PeptideAtlas | O76013. |
| PRIDE | O76013. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000328119; ENSP00000329165; ENSG00000126337. |
| GeneID | 8689. |
| KEGG | hsa:8689. |
| UCSC | uc002hwt.1. human. |
Organism-specific databases | |
| CTD | 8689. |
| GeneCards | GC17M039642. |
| H-InvDB | HIX0027332. |
| HGNC | HGNC:6454. KRT36. |
| HPA | HPA021426. |
| MIM | 604540. gene. |
| neXtProt | NX_O76013. |
| PharmGKB | PA30243. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG07105. |
| GeneTree | ENSGT00560000076638. |
| HOGENOM | HBG715391. |
| HOVERGEN | HBG013015. |
| InParanoid | O76013. |
| OMA | ILDDMRC. |
| PhylomeDB | O76013. |
Gene expression databases | |
| ArrayExpress | O76013. |
| Bgee | O76013. |
| CleanEx | HS_KRT36. |
| Genevestigator | O76013. |
| GermOnline | ENSG00000126337. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR016044. F. IPR001664. IF. IPR018039. Intermediate_filament_CS. IPR002957. Keratin_I. [Graphical view] |
| KO | K07604. |
| PANTHER | PTHR23239. IF. 1 hit. |
| Pfam | PF00038. Filament. 1 hit. [Graphical view] |
| PRINTS | PR01248. TYPE1KERATIN. |
| PROSITE | PS00226. IF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 32587. |
| SOURCE | Search... |
Entry information
| Entry name | KRT36_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O76013 Secondary accession number(s): Q86XG4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with