Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Keratin, type I cuticular Ha6

Gene

KRT36

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei342Stutter1

GO - Molecular functioni

  • structural constituent of epidermis Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-6805567. Keratinization.
R-HSA-6809371. Formation of the cornified envelope.

Names & Taxonomyi

Protein namesi
Recommended name:
Keratin, type I cuticular Ha6
Alternative name(s):
Hair keratin, type I Ha6
Keratin-36
Short name:
K36
Gene namesi
Name:KRT36
Synonyms:HHA6, HKA6, KRTHA6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:6454. KRT36.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • intermediate filament Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Intermediate filament, Keratin

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000126337.
PharmGKBiPA30243.

Polymorphism and mutation databases

BioMutaiKRT36.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000636931 – 467Keratin, type I cuticular Ha6Add BLAST467

Proteomic databases

PaxDbiO76013.
PeptideAtlasiO76013.
PRIDEiO76013.

PTM databases

iPTMnetiO76013.
PhosphoSitePlusiO76013.

Expressioni

Tissue specificityi

Expressed in the hair follicles.1 Publication

Gene expression databases

BgeeiENSG00000126337.
CleanExiHS_KRT36.
GenevisibleiO76013. HS.

Organism-specific databases

HPAiHPA021426.

Interactioni

Subunit structurei

Heterotetramer of two type I and two type II keratins.By similarity

Protein-protein interaction databases

BioGridi114236. 9 interactors.
IntActiO76013. 26 interactors.
MINTiMINT-6769057.
STRINGi9606.ENSP00000329165.

Structurei

3D structure databases

ProteinModelPortaliO76013.
SMRiO76013.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 93HeadAdd BLAST93
Regioni94 – 400RodAdd BLAST307
Regioni94 – 128Coil 1AAdd BLAST35
Regioni129 – 139Linker 1Add BLAST11
Regioni140 – 240Coil 1BAdd BLAST101
Regioni241 – 256Linker 12Add BLAST16
Regioni257 – 400Coil 2Add BLAST144
Regioni401 – 467TailAdd BLAST67

Sequence similaritiesi

Belongs to the intermediate filament family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IFTF. Eukaryota.
ENOG410Y9IV. LUCA.
GeneTreeiENSGT00760000118808.
HOGENOMiHOG000230975.
HOVERGENiHBG013015.
InParanoidiO76013.
KOiK07604.
OMAiILEDMRC.
OrthoDBiEOG091G087I.
PhylomeDBiO76013.
TreeFamiTF332742.

Family and domain databases

InterProiIPR001664. IF.
IPR018039. Intermediate_filament_CS.
IPR002957. Keratin_I.
IPR009053. Prefoldin.
[Graphical view]
PANTHERiPTHR23239. PTHR23239. 1 hit.
PfamiPF00038. Filament. 1 hit.
[Graphical view]
PRINTSiPR01248. TYPE1KERATIN.
SMARTiSM01391. Filament. 1 hit.
[Graphical view]
SUPFAMiSSF46579. SSF46579. 1 hit.
PROSITEiPS00226. IF. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O76013-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATQTCTPTF STGSIKGLCG TAGGISRVSS IRSVGSCRVP SLAGAAGYIS
60 70 80 90 100
SARSGLSGLG SCLPGSYLSS ECHTSGFVGS GGWFCEGSFN GSEKETMQFL
110 120 130 140 150
NDRLANYLEK VRQLERENAE LESRIQEWYE FQIPYICPDY QSYFKTIEDF
160 170 180 190 200
QQKILLTKSE NARLVLQIDN AKLAADDFRT KYETELSLRQ LVEADINGLR
210 220 230 240 250
RILDELTLCK ADLEAQVESL KEELMCLKKN HEEEVSVLRC QLGDRLNVEV
260 270 280 290 300
DAAPPVDLNK ILEDMRCQYE ALVENNRRDV EAWFNTQTEE LNQQVVSSSE
310 320 330 340 350
QLQCCQTEII ELRRTVNALE IELQAQHSMR NSLESTLAET EARYSSQLAQ
360 370 380 390 400
MQCLISNVEA QLSEIRCDLE RQNQEYQVLL DVKARLEGEI ATYRHLLEGE
410 420 430 440 450
DCKLPPQPCA TACKPVIRVP SVPPVPCVPS VPCTPAPQVG TQIRTITEEI
460
RDGKVISSRE HVQSRPL
Length:467
Mass (Da):52,247
Last modified:November 1, 1998 - v1
Checksum:i492B3B2DE3BCAECD
GO
Isoform 2 (identifier: O76013-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSA → ML

Note: No experimental confirmation available.
Show »
Length:417
Mass (Da):47,485
Checksum:iD27B5052EDC12A3B
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024490119A → V.Corresponds to variant rs8082683dbSNPEnsembl.1
Natural variantiVAR_024491126Q → R.Corresponds to variant rs8069943dbSNPEnsembl.1
Natural variantiVAR_049792179R → Q.Corresponds to variant rs9675246dbSNPEnsembl.1
Natural variantiVAR_049793277R → C.Corresponds to variant rs9904102dbSNPEnsembl.1
Natural variantiVAR_020306315T → M.Corresponds to variant rs2301354dbSNPEnsembl.1
Natural variantiVAR_049794357N → T.Corresponds to variant rs11657323dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0364031 – 52MATQT…YISSA → ML in isoform 2. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16792 Genomic DNA. Translation: CAA76388.1.
CH471152 Genomic DNA. Translation: EAW60738.1.
BC043581 mRNA. Translation: AAH43581.1.
CCDSiCCDS11395.1. [O76013-1]
RefSeqiNP_003762.1. NM_003771.4. [O76013-1]
UniGeneiHs.248189.

Genome annotation databases

EnsembliENST00000328119; ENSP00000329165; ENSG00000126337. [O76013-1]
ENST00000393986; ENSP00000377555; ENSG00000126337. [O76013-2]
GeneIDi8689.
KEGGihsa:8689.
UCSCiuc002hwt.3. human. [O76013-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16792 Genomic DNA. Translation: CAA76388.1.
CH471152 Genomic DNA. Translation: EAW60738.1.
BC043581 mRNA. Translation: AAH43581.1.
CCDSiCCDS11395.1. [O76013-1]
RefSeqiNP_003762.1. NM_003771.4. [O76013-1]
UniGeneiHs.248189.

3D structure databases

ProteinModelPortaliO76013.
SMRiO76013.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114236. 9 interactors.
IntActiO76013. 26 interactors.
MINTiMINT-6769057.
STRINGi9606.ENSP00000329165.

PTM databases

iPTMnetiO76013.
PhosphoSitePlusiO76013.

Polymorphism and mutation databases

BioMutaiKRT36.

Proteomic databases

PaxDbiO76013.
PeptideAtlasiO76013.
PRIDEiO76013.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328119; ENSP00000329165; ENSG00000126337. [O76013-1]
ENST00000393986; ENSP00000377555; ENSG00000126337. [O76013-2]
GeneIDi8689.
KEGGihsa:8689.
UCSCiuc002hwt.3. human. [O76013-1]

Organism-specific databases

CTDi8689.
GeneCardsiKRT36.
H-InvDBHIX0027332.
HGNCiHGNC:6454. KRT36.
HPAiHPA021426.
MIMi604540. gene.
neXtProtiNX_O76013.
OpenTargetsiENSG00000126337.
PharmGKBiPA30243.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFTF. Eukaryota.
ENOG410Y9IV. LUCA.
GeneTreeiENSGT00760000118808.
HOGENOMiHOG000230975.
HOVERGENiHBG013015.
InParanoidiO76013.
KOiK07604.
OMAiILEDMRC.
OrthoDBiEOG091G087I.
PhylomeDBiO76013.
TreeFamiTF332742.

Enzyme and pathway databases

ReactomeiR-HSA-6805567. Keratinization.
R-HSA-6809371. Formation of the cornified envelope.

Miscellaneous databases

GeneWikiiKRT36.
GenomeRNAii8689.
PROiO76013.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000126337.
CleanExiHS_KRT36.
GenevisibleiO76013. HS.

Family and domain databases

InterProiIPR001664. IF.
IPR018039. Intermediate_filament_CS.
IPR002957. Keratin_I.
IPR009053. Prefoldin.
[Graphical view]
PANTHERiPTHR23239. PTHR23239. 1 hit.
PfamiPF00038. Filament. 1 hit.
[Graphical view]
PRINTSiPR01248. TYPE1KERATIN.
SMARTiSM01391. Filament. 1 hit.
[Graphical view]
SUPFAMiSSF46579. SSF46579. 1 hit.
PROSITEiPS00226. IF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKRT36_HUMAN
AccessioniPrimary (citable) accession number: O76013
Secondary accession number(s): Q86XG4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: November 30, 2016
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

There are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic).

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.