Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O76013 (KRT36_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 115. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Keratin, type I cuticular Ha6
Alternative name(s):
Hair keratin, type I Ha6
Keratin-36
Short name=K36
Gene names
Name:KRT36
Synonyms:HHA6, HKA6, KRTHA6
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length467 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subunit structure

Heterotetramer of two type I and two type II keratins By similarity.

Tissue specificity

Expressed in the hair follicles. Ref.1

Miscellaneous

There are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic).

Sequence similarities

Belongs to the intermediate filament family.

Ontologies

Keywords
   Cellular componentIntermediate filament
Keratin
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processregulation of keratinocyte differentiation

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentintermediate filament

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functionstructural constituent of epidermis

Non-traceable author statement Ref.1. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O76013-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O76013-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSA → ML
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 467467Keratin, type I cuticular Ha6
PRO_0000063693

Regions

Region1 – 9393Head
Region94 – 400307Rod
Region94 – 12835Coil 1A
Region129 – 13911Linker 1
Region140 – 240101Coil 1B
Region241 – 25616Linker 12
Region257 – 400144Coil 2
Region401 – 46767Tail

Sites

Site3421Stutter

Natural variations

Alternative sequence1 – 5252MATQT…YISSA → ML in isoform 2.
VSP_036403
Natural variant1191A → V.
Corresponds to variant rs8082683 [ dbSNP | Ensembl ].
VAR_024490
Natural variant1261Q → R.
Corresponds to variant rs8069943 [ dbSNP | Ensembl ].
VAR_024491
Natural variant1791R → Q.
Corresponds to variant rs9675246 [ dbSNP | Ensembl ].
VAR_049792
Natural variant2771R → C.
Corresponds to variant rs9904102 [ dbSNP | Ensembl ].
VAR_049793
Natural variant3151T → M.
Corresponds to variant rs2301354 [ dbSNP | Ensembl ].
VAR_020306
Natural variant3571N → T.
Corresponds to variant rs11657323 [ dbSNP | Ensembl ].
VAR_049794

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1998. Version 1.
Checksum: 492B3B2DE3BCAECD

FASTA46752,247
        10         20         30         40         50         60 
MATQTCTPTF STGSIKGLCG TAGGISRVSS IRSVGSCRVP SLAGAAGYIS SARSGLSGLG 

        70         80         90        100        110        120 
SCLPGSYLSS ECHTSGFVGS GGWFCEGSFN GSEKETMQFL NDRLANYLEK VRQLERENAE 

       130        140        150        160        170        180 
LESRIQEWYE FQIPYICPDY QSYFKTIEDF QQKILLTKSE NARLVLQIDN AKLAADDFRT 

       190        200        210        220        230        240 
KYETELSLRQ LVEADINGLR RILDELTLCK ADLEAQVESL KEELMCLKKN HEEEVSVLRC 

       250        260        270        280        290        300 
QLGDRLNVEV DAAPPVDLNK ILEDMRCQYE ALVENNRRDV EAWFNTQTEE LNQQVVSSSE 

       310        320        330        340        350        360 
QLQCCQTEII ELRRTVNALE IELQAQHSMR NSLESTLAET EARYSSQLAQ MQCLISNVEA 

       370        380        390        400        410        420 
QLSEIRCDLE RQNQEYQVLL DVKARLEGEI ATYRHLLEGE DCKLPPQPCA TACKPVIRVP 

       430        440        450        460 
SVPPVPCVPS VPCTPAPQVG TQIRTITEEI RDGKVISSRE HVQSRPL 

« Hide

Isoform 2 [UniParc].

Checksum: D27B5052EDC12A3B
Show »

FASTA41747,485

References

« Hide 'large scale' references
[1]"Characterization of a 190-kilobase pair domain of human type I hair keratin genes."
Rogers M.A., Winter H., Wolf C., Heck M., Schweizer J.
J. Biol. Chem. 273:26683-26691(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1), TISSUE SPECIFICITY.
[2]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Y16792 Genomic DNA. Translation: CAA76388.1.
CH471152 Genomic DNA. Translation: EAW60738.1.
BC043581 mRNA. Translation: AAH43581.1.
CCDSCCDS11395.1. [O76013-1]
RefSeqNP_003762.1. NM_003771.4. [O76013-1]
XP_005257819.1. XM_005257762.2. [O76013-2]
UniGeneHs.248189.

3D structure databases

ProteinModelPortalO76013.
SMRO76013. Positions 96-128, 143-241, 311-399.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114236. 8 interactions.
IntActO76013. 7 interactions.
MINTMINT-6769057.
STRING9606.ENSP00000329165.

PTM databases

PhosphoSiteO76013.

Proteomic databases

MaxQBO76013.
PaxDbO76013.
PeptideAtlasO76013.
PRIDEO76013.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000328119; ENSP00000329165; ENSG00000126337. [O76013-1]
ENST00000393986; ENSP00000377555; ENSG00000126337. [O76013-2]
GeneID8689.
KEGGhsa:8689.
UCSCuc002hwt.3. human. [O76013-1]

Organism-specific databases

CTD8689.
GeneCardsGC17M039642.
H-InvDBHIX0027332.
HGNCHGNC:6454. KRT36.
HPAHPA021426.
MIM604540. gene.
neXtProtNX_O76013.
PharmGKBPA30243.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG145287.
HOGENOMHOG000230975.
HOVERGENHBG013015.
InParanoidO76013.
KOK07604.
OMAVGTQIRT.
OrthoDBEOG7FV3Q8.
PhylomeDBO76013.
TreeFamTF332742.

Gene expression databases

BgeeO76013.
CleanExHS_KRT36.
GenevestigatorO76013.

Family and domain databases

InterProIPR001664. IF.
IPR018039. Intermediate_filament_CS.
IPR002957. Keratin_I.
IPR009053. Prefoldin.
[Graphical view]
PANTHERPTHR23239. PTHR23239. 1 hit.
PfamPF00038. Filament. 1 hit.
[Graphical view]
PRINTSPR01248. TYPE1KERATIN.
SUPFAMSSF46579. SSF46579. 1 hit.
PROSITEPS00226. IF. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiKRT36.
GenomeRNAi8689.
NextBio32587.
PROO76013.
SOURCESearch...

Entry information

Entry nameKRT36_HUMAN
AccessionPrimary (citable) accession number: O76013
Secondary accession number(s): Q86XG4
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: July 9, 2014
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM