Reviewed,
UniProtKB/Swiss-Prot O75953 (DNJB5_HUMAN)
Last modified
March 2, 2010.
Version 75.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: DnaJ homolog subfamily B member 5 Alternative name(s): Heat shock protein Hsp40-2 Heat shock protein Hsp40-3 Heat shock protein cognate 40 Short name=Hsc40 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 348 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Induction | Expressed under normal conditions, its expression can further be increased after various stress treatments. |
| Sequence similarities | Contains 1 J domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Molecular function | Chaperone |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | protein folding Inferred from electronic annotation. Source: InterPro response to unfolded protein Ref.1Inferred from expression pattern. Source: UniProtKB |
| Molecular function | heat shock protein binding Inferred from electronic annotation. Source: InterPro unfolded protein bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75953-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75953-2) The sequence of this isoform differs from the canonical sequence as follows: 344-348: HLPCS → QYPQHSLHSMCTQLDVHWTLATFSKMQKKATGFQENVPVPDPF | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 348 | 348 | DnaJ homolog subfamily B member 5 | PRO_0000071023 | |||||
Regions | |||||||||
| Domain | 4 – 68 | 65 | J | ||||||
Natural variations | |||||||||
| Alternative sequence | 344 – 348 | 5 | HLPCS → QYPQHSLHSMCTQLDVHWTL ATFSKMQKKATGFQENVPVP DPF in isoform 2. | VSP_030167 | |||||
Experimental info | |||||||||
| Sequence conflict | 190 – 196 | 7 | MKITRRR → IEDHKAS in AAM10498. Ref.2 | ||||||
| Sequence conflict | 234 – 235 | 2 | TP → HL in AAM10498. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Hsc40, a new member of the hsp40 family, exhibits similar expression profile to that of hsc70 in mammalian cells." Chen M.-S., Roti J.R., Laszlo A. Gene 238:333-341(1999) [PubMed: 10570961] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Colon. |
| [2] | "Cloning and expression of a new human cDNA homology to human heat-shock protein 40 mRNA." Fu Q., Yu L., Yue P., Zhou Y., Jiang J.X., Zhao S.Y. Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed: 15164053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Skin. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF088982 mRNA. Translation: AAC35860.1. AF087870 mRNA. Translation: AAM10498.1. AK023253 mRNA. Translation: BAG51176.1. AL355377 Genomic DNA. Translation: CAI13810.1. CH471071 Genomic DNA. Translation: EAW58407.1. BC012115 mRNA. Translation: AAH12115.1. |
| IPI | IPI00016855. IPI00871830. |
| RefSeq | NP_001128476.1. NP_001128477.1. NP_036398.3. |
| UniGene | Hs.237506 |
3D structure databases | |
| SMR | O75953. Positions 1-76, 169-342. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O75953. |
Proteomic databases | |
| PRIDE | O75953. |
Genome annotation databases | |
| Ensembl | ENST00000312316; ENSP00000312517; ENSG00000137094; Homo sapiens. [Genome view] ENST00000335998; ENSP00000337626; ENSG00000137094; Homo sapiens. [Genome view] ENST00000453597; ENSP00000404079; ENSG00000137094; Homo sapiens. [Genome view] ENST00000454002; ENSP00000413684; ENSG00000137094; Homo sapiens. [Genome view] |
| GeneID | 25822. |
| KEGG | hsa:25822. |
| UCSC | uc003zvs.1. human. |
Organism-specific databases | |
| CTD | 25822. |
| GeneCards | GC09P034979. |
| H-InvDB | HIX0008007. |
| HGNC | HGNC:14887. DNAJB5. |
| HPA | HPA023818. |
| MIM | 611328. gene. |
| PharmGKB | PA27417. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG08373. |
| HOVERGEN | HBG066727. |
| OMA | DVHWTLA. |
| OrthoDB | EOG9NP9PN. |
| PhylomeDB | O75953. |
Gene expression databases | |
| ArrayExpress | O75953. |
| Bgee | O75953. |
| CleanEx | HS_DNAJB5. |
| Genevestigator | O75953. |
| GermOnline | ENSG00000137094. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002939. DnaJ_C. IPR001623. DnaJ_N. IPR018253. Heat_shock_DnaJ_CS. IPR008971. HSP40/DnaJ_pept-bd. IPR015609. Hsp40/DnaJ_Rel. IPR003095. Hsp_DnaJ. [Graphical view] |
| Gene3D | G3DSA:1.10.287.110. DnaJ_N. 1 hit. |
| PANTHER | PTHR11821. Hsp40/DnaJ_Rel. 1 hit. |
| Pfam | PF00226. DnaJ. 1 hit. PF01556. DnaJ_C. 1 hit. [Graphical view] |
| PRINTS | PR00625. DNAJPROTEIN. |
| SMART | SM00271. DnaJ. 1 hit. [Graphical view] |
| SUPFAM | SSF46565. DnaJ_N. 1 hit. SSF49493. HSP40_DnaJ_pep. 2 hits. |
| PROSITE | PS00636. DNAJ_1. 1 hit. PS50076. DNAJ_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 47081. |
| SOURCE | Search... |
Entry information
| Entry name | DNJB5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75953 Secondary accession number(s): B3KN14 Q96EM4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


