Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DnaJ homolog subfamily B member 5

Gene

DNAJB5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • chaperone binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Names & Taxonomyi

Protein namesi
Recommended name:
DnaJ homolog subfamily B member 5
Alternative name(s):
Heat shock protein Hsp40-2
Heat shock protein Hsp40-3
Heat shock protein cognate 40
Short name:
Hsc40
Gene namesi
Name:DNAJB5
Synonyms:HSC40
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:14887. DNAJB5.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: UniProtKB
  • nucleus Source: Ensembl
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27417.

Polymorphism and mutation databases

BioMutaiDNAJB5.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 348348DnaJ homolog subfamily B member 5PRO_0000071023Add
BLAST

Proteomic databases

EPDiO75953.
MaxQBiO75953.
PaxDbiO75953.
PRIDEiO75953.

PTM databases

iPTMnetiO75953.
PhosphoSiteiO75953.

Expressioni

Inductioni

Expressed under normal conditions, its expression can further be increased after various stress treatments.

Gene expression databases

BgeeiO75953.
CleanExiHS_DNAJB5.
ExpressionAtlasiO75953. baseline and differential.
GenevisibleiO75953. HS.

Organism-specific databases

HPAiHPA023818.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CACNA1AO005552EBI-5655937,EBI-766279
EBNA-LPQ8AZK72EBI-5655937,EBI-1185167From a different organism.
TTNQ8WZ424EBI-5655937,EBI-681210

GO - Molecular functioni

  • chaperone binding Source: UniProtKB

Protein-protein interaction databases

BioGridi117350. 32 interactions.
IntActiO75953. 15 interactions.
MINTiMINT-6733004.
STRINGi9606.ENSP00000404079.

Structurei

3D structure databases

ProteinModelPortaliO75953.
SMRiO75953. Positions 1-346.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 6865JPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 J domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0714. Eukaryota.
COG0484. LUCA.
GeneTreeiENSGT00760000118947.
HOGENOMiHOG000226718.
HOVERGENiHBG066727.
InParanoidiO75953.
KOiK09511.
OMAiFWGEDFL.
OrthoDBiEOG7TF79F.
PhylomeDBiO75953.
TreeFamiTF105141.

Family and domain databases

Gene3Di1.10.287.110. 1 hit.
InterProiIPR002939. DnaJ_C.
IPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
IPR008971. HSP40/DnaJ_pept-bd.
[Graphical view]
PfamiPF00226. DnaJ. 1 hit.
PF01556. DnaJ_C. 1 hit.
[Graphical view]
PRINTSiPR00625. JDOMAIN.
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
SSF49493. SSF49493. 2 hits.
PROSITEiPS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75953-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKDYYKILG IPSGANEDEI KKAYRKMALK YHPDKNKEPN AEEKFKEIAE
60 70 80 90 100
AYDVLSDPKK RGLYDQYGEE GLKTGGGTSG GSSGSFHYTF HGDPHATFAS
110 120 130 140 150
FFGGSNPFDI FFASSRSTRP FSGFDPDDMD VDEDEDPFGA FGRFGFNGLS
160 170 180 190 200
RGPRRAPEPL YPRRKVQDPP VVHELRVSLE EIYHGSTKRM KITRRRLNPD
210 220 230 240 250
GRTVRTEDKI LHIVIKRGWK EGTKITFPKE GDATPDNIPA DIVFVLKDKP
260 270 280 290 300
HAHFRRDGTN VLYSALISLK EALCGCTVNI PTIDGRVIPL PCNDVIKPGT
310 320 330 340
VKRLRGEGLP FPKVPTQRGD LIVEFKVRFP DRLTPQTRQI LKQHLPCS
Length:348
Mass (Da):39,133
Last modified:November 1, 1998 - v1
Checksum:iDC9FE45DE4FD8CFC
GO
Isoform 2 (identifier: O75953-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFKRTVLSCPPPAAPPLQARGAFRSFPHSWGEDFLASLMFKIQLEPLKLRAWTLNGFVKFRNKETSAGPVAVM

Show »
Length:420
Mass (Da):47,175
Checksum:i946F7B3E1D71BFB2
GO
Isoform 3 (identifier: O75953-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGAEAEPWG...ETSAGPVAVM

Note: Gene prediction based on EST data.
Show »
Length:462
Mass (Da):51,689
Checksum:iB5F3CFA21A956470
GO

Sequence cautioni

The sequence AAH12115.1 differs from that shown.Unlikely isoform. Aberrant splice sites.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti190 – 1967MKITRRR → IEDHKAS in AAM10498 (Ref. 2) Curated
Sequence conflicti234 – 2352TP → HL in AAM10498 (Ref. 2) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MFKRTVLSCPPPAAPPLQAR GAFRSFPHSWGEDFLASLMF KIQLEPLKLRAWTLNGFVKF RNKETSAGPVAVM in isoform 2. 1 PublicationVSP_046223
Alternative sequencei1 – 11M → MGGAEAEPWGRAPGPAIGGR RAGDSCPGWRRRSRSRGRGQ RLSHGPRRRPQLLTAAPPLQ ARGAFRSFPHSWGEDFLASL MFKIQLEPLKLRAWTLNGFV KFRNKETSAGPVAVM in isoform 3. CuratedVSP_047250

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF088982 mRNA. Translation: AAC35860.1.
AF087870 mRNA. Translation: AAM10498.1.
AK023253 mRNA. Translation: BAG51176.1.
AK299647 mRNA. Translation: BAG61568.1.
AL355377 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58407.1.
BC012115 mRNA. Translation: AAH12115.1. Sequence problems.
CCDSiCCDS35007.1. [O75953-3]
CCDS47959.1. [O75953-4]
CCDS47960.2. [O75953-5]
RefSeqiNP_001128476.2. NM_001135004.2. [O75953-5]
NP_001128477.1. NM_001135005.2. [O75953-4]
NP_036398.3. NM_012266.5. [O75953-3]
XP_005251485.1. XM_005251428.3. [O75953-3]
XP_006716814.1. XM_006716751.2. [O75953-3]
XP_011516144.1. XM_011517842.1. [O75953-4]
UniGeneiHs.237506.

Genome annotation databases

EnsembliENST00000312316; ENSP00000312517; ENSG00000137094. [O75953-3]
ENST00000453597; ENSP00000404079; ENSG00000137094. [O75953-5]
ENST00000454002; ENSP00000413684; ENSG00000137094. [O75953-4]
ENST00000545841; ENSP00000441999; ENSG00000137094. [O75953-3]
GeneIDi25822.
KEGGihsa:25822.
UCSCiuc003zvs.5. human. [O75953-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF088982 mRNA. Translation: AAC35860.1.
AF087870 mRNA. Translation: AAM10498.1.
AK023253 mRNA. Translation: BAG51176.1.
AK299647 mRNA. Translation: BAG61568.1.
AL355377 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58407.1.
BC012115 mRNA. Translation: AAH12115.1. Sequence problems.
CCDSiCCDS35007.1. [O75953-3]
CCDS47959.1. [O75953-4]
CCDS47960.2. [O75953-5]
RefSeqiNP_001128476.2. NM_001135004.2. [O75953-5]
NP_001128477.1. NM_001135005.2. [O75953-4]
NP_036398.3. NM_012266.5. [O75953-3]
XP_005251485.1. XM_005251428.3. [O75953-3]
XP_006716814.1. XM_006716751.2. [O75953-3]
XP_011516144.1. XM_011517842.1. [O75953-4]
UniGeneiHs.237506.

3D structure databases

ProteinModelPortaliO75953.
SMRiO75953. Positions 1-346.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117350. 32 interactions.
IntActiO75953. 15 interactions.
MINTiMINT-6733004.
STRINGi9606.ENSP00000404079.

PTM databases

iPTMnetiO75953.
PhosphoSiteiO75953.

Polymorphism and mutation databases

BioMutaiDNAJB5.

Proteomic databases

EPDiO75953.
MaxQBiO75953.
PaxDbiO75953.
PRIDEiO75953.

Protocols and materials databases

DNASUi25822.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000312316; ENSP00000312517; ENSG00000137094. [O75953-3]
ENST00000453597; ENSP00000404079; ENSG00000137094. [O75953-5]
ENST00000454002; ENSP00000413684; ENSG00000137094. [O75953-4]
ENST00000545841; ENSP00000441999; ENSG00000137094. [O75953-3]
GeneIDi25822.
KEGGihsa:25822.
UCSCiuc003zvs.5. human. [O75953-3]

Organism-specific databases

CTDi25822.
GeneCardsiDNAJB5.
HGNCiHGNC:14887. DNAJB5.
HPAiHPA023818.
MIMi611328. gene.
neXtProtiNX_O75953.
PharmGKBiPA27417.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0714. Eukaryota.
COG0484. LUCA.
GeneTreeiENSGT00760000118947.
HOGENOMiHOG000226718.
HOVERGENiHBG066727.
InParanoidiO75953.
KOiK09511.
OMAiFWGEDFL.
OrthoDBiEOG7TF79F.
PhylomeDBiO75953.
TreeFamiTF105141.

Miscellaneous databases

GenomeRNAii25822.
PROiO75953.
SOURCEiSearch...

Gene expression databases

BgeeiO75953.
CleanExiHS_DNAJB5.
ExpressionAtlasiO75953. baseline and differential.
GenevisibleiO75953. HS.

Family and domain databases

Gene3Di1.10.287.110. 1 hit.
InterProiIPR002939. DnaJ_C.
IPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
IPR008971. HSP40/DnaJ_pept-bd.
[Graphical view]
PfamiPF00226. DnaJ. 1 hit.
PF01556. DnaJ_C. 1 hit.
[Graphical view]
PRINTSiPR00625. JDOMAIN.
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
SSF49493. SSF49493. 2 hits.
PROSITEiPS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Hsc40, a new member of the hsp40 family, exhibits similar expression profile to that of hsc70 in mammalian cells."
    Chen M.-S., Roti J.R., Laszlo A.
    Gene 238:333-341(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Colon.
  2. "Cloning and expression of a new human cDNA homology to human heat-shock protein 40 mRNA."
    Fu Q., Yu L., Yue P., Zhou Y., Jiang J.X., Zhao S.Y.
    Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  4. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Skin.

Entry informationi

Entry nameiDNJB5_HUMAN
AccessioniPrimary (citable) accession number: O75953
Secondary accession number(s): B3KN14
, B4DSA6, J3KQM9, J3KR08, Q5T656, Q8TDR7, Q96EM4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: November 1, 1998
Last modified: June 8, 2016
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.