Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DnaJ homolog subfamily B member 5

Gene

DNAJB5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • chaperone binding Source: UniProtKB
  • unfolded protein binding Source: InterPro

GO - Biological processi

Keywordsi

Molecular functionChaperone

Names & Taxonomyi

Protein namesi
Recommended name:
DnaJ homolog subfamily B member 5
Alternative name(s):
Heat shock protein Hsp40-2
Heat shock protein Hsp40-3
Heat shock protein cognate 40
Short name:
Hsc40
Gene namesi
Name:DNAJB5
Synonyms:HSC40
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000137094.14
HGNCiHGNC:14887 DNAJB5
MIMi611328 gene
neXtProtiNX_O75953

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000137094
PharmGKBiPA27417

Polymorphism and mutation databases

BioMutaiDNAJB5

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000710231 – 348DnaJ homolog subfamily B member 5Add BLAST348

Proteomic databases

EPDiO75953
MaxQBiO75953
PaxDbiO75953
PeptideAtlasiO75953
PRIDEiO75953

PTM databases

iPTMnetiO75953
PhosphoSitePlusiO75953

Expressioni

Inductioni

Expressed under normal conditions, its expression can further be increased after various stress treatments.

Gene expression databases

BgeeiENSG00000137094
CleanExiHS_DNAJB5
ExpressionAtlasiO75953 baseline and differential
GenevisibleiO75953 HS

Organism-specific databases

HPAiHPA023818
HPA050794

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

  • chaperone binding Source: UniProtKB
  • unfolded protein binding Source: InterPro

Protein-protein interaction databases

BioGridi117350, 35 interactors
IntActiO75953, 16 interactors
MINTiO75953
STRINGi9606.ENSP00000404079

Structurei

3D structure databases

ProteinModelPortaliO75953
SMRiO75953
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 68JPROSITE-ProRule annotationAdd BLAST65

Phylogenomic databases

eggNOGiKOG0714 Eukaryota
COG0484 LUCA
GeneTreeiENSGT00760000118947
HOGENOMiHOG000226718
HOVERGENiHBG066727
InParanoidiO75953
KOiK09511
OMAiGRTMVVE
OrthoDBiEOG091G0DLS
PhylomeDBiO75953
TreeFamiTF105141

Family and domain databases

CDDicd06257 DnaJ, 1 hit
Gene3Di1.10.287.110, 1 hit
InterProiView protein in InterPro
IPR002939 DnaJ_C
IPR001623 DnaJ_domain
IPR018253 DnaJ_domain_CS
IPR008971 HSP40/DnaJ_pept-bd
IPR036869 J_dom_sf
PfamiView protein in Pfam
PF00226 DnaJ, 1 hit
PF01556 DnaJ_C, 1 hit
PRINTSiPR00625 JDOMAIN
SMARTiView protein in SMART
SM00271 DnaJ, 1 hit
SUPFAMiSSF46565 SSF46565, 1 hit
SSF49493 SSF49493, 2 hits
PROSITEiView protein in PROSITE
PS00636 DNAJ_1, 1 hit
PS50076 DNAJ_2, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75953-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKDYYKILG IPSGANEDEI KKAYRKMALK YHPDKNKEPN AEEKFKEIAE
60 70 80 90 100
AYDVLSDPKK RGLYDQYGEE GLKTGGGTSG GSSGSFHYTF HGDPHATFAS
110 120 130 140 150
FFGGSNPFDI FFASSRSTRP FSGFDPDDMD VDEDEDPFGA FGRFGFNGLS
160 170 180 190 200
RGPRRAPEPL YPRRKVQDPP VVHELRVSLE EIYHGSTKRM KITRRRLNPD
210 220 230 240 250
GRTVRTEDKI LHIVIKRGWK EGTKITFPKE GDATPDNIPA DIVFVLKDKP
260 270 280 290 300
HAHFRRDGTN VLYSALISLK EALCGCTVNI PTIDGRVIPL PCNDVIKPGT
310 320 330 340
VKRLRGEGLP FPKVPTQRGD LIVEFKVRFP DRLTPQTRQI LKQHLPCS
Length:348
Mass (Da):39,133
Last modified:November 1, 1998 - v1
Checksum:iDC9FE45DE4FD8CFC
GO
Isoform 2 (identifier: O75953-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFKRTVLSCPPPAAPPLQARGAFRSFPHSWGEDFLASLMFKIQLEPLKLRAWTLNGFVKFRNKETSAGPVAVM

Show »
Length:420
Mass (Da):47,175
Checksum:i946F7B3E1D71BFB2
GO
Isoform 3 (identifier: O75953-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGAEAEPWG...ETSAGPVAVM

Note: Gene prediction based on EST data.
Show »
Length:462
Mass (Da):51,689
Checksum:iB5F3CFA21A956470
GO

Sequence cautioni

The sequence AAH12115 differs from that shown. Unlikely isoform. Aberrant splice sites.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti190 – 196MKITRRR → IEDHKAS in AAM10498 (Ref. 2) Curated7
Sequence conflicti234 – 235TP → HL in AAM10498 (Ref. 2) Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0462231M → MFKRTVLSCPPPAAPPLQAR GAFRSFPHSWGEDFLASLMF KIQLEPLKLRAWTLNGFVKF RNKETSAGPVAVM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0472501M → MGGAEAEPWGRAPGPAIGGR RAGDSCPGWRRRSRSRGRGQ RLSHGPRRRPQLLTAAPPLQ ARGAFRSFPHSWGEDFLASL MFKIQLEPLKLRAWTLNGFV KFRNKETSAGPVAVM in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF088982 mRNA Translation: AAC35860.1
AF087870 mRNA Translation: AAM10498.1
AK023253 mRNA Translation: BAG51176.1
AK299647 mRNA Translation: BAG61568.1
AL355377 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58407.1
BC012115 mRNA Translation: AAH12115.1 Sequence problems.
CCDSiCCDS35007.1 [O75953-3]
CCDS47959.1 [O75953-4]
CCDS47960.2 [O75953-5]
RefSeqiNP_001128476.2, NM_001135004.2 [O75953-5]
NP_001128477.1, NM_001135005.2 [O75953-4]
NP_036398.3, NM_012266.5 [O75953-3]
XP_005251485.1, XM_005251428.3 [O75953-3]
XP_006716814.1, XM_006716751.2 [O75953-3]
XP_011516144.1, XM_011517842.2 [O75953-4]
UniGeneiHs.237506

Genome annotation databases

EnsembliENST00000312316; ENSP00000312517; ENSG00000137094 [O75953-3]
ENST00000453597; ENSP00000404079; ENSG00000137094 [O75953-5]
ENST00000454002; ENSP00000413684; ENSG00000137094 [O75953-4]
ENST00000545841; ENSP00000441999; ENSG00000137094 [O75953-3]
GeneIDi25822
KEGGihsa:25822
UCSCiuc003zvs.5 human [O75953-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDNJB5_HUMAN
AccessioniPrimary (citable) accession number: O75953
Secondary accession number(s): B3KN14
, B4DSA6, J3KQM9, J3KR08, Q5T656, Q8TDR7, Q96EM4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: November 1, 1998
Last modified: March 28, 2018
This is version 142 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health