Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DnaJ homolog subfamily B member 5

Gene

DNAJB5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • chaperone binding Source: UniProtKB
  • unfolded protein binding Source: InterPro

GO - Biological processi

Keywordsi

Molecular functionChaperone

Names & Taxonomyi

Protein namesi
Recommended name:
DnaJ homolog subfamily B member 5
Alternative name(s):
Heat shock protein Hsp40-2
Heat shock protein Hsp40-3
Heat shock protein cognate 40
Short name:
Hsc40
Gene namesi
Name:DNAJB5
Synonyms:HSC40
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000137094.14.
HGNCiHGNC:14887. DNAJB5.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000137094.
PharmGKBiPA27417.

Polymorphism and mutation databases

BioMutaiDNAJB5.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000710231 – 348DnaJ homolog subfamily B member 5Add BLAST348

Proteomic databases

EPDiO75953.
MaxQBiO75953.
PaxDbiO75953.
PeptideAtlasiO75953.
PRIDEiO75953.

PTM databases

iPTMnetiO75953.
PhosphoSitePlusiO75953.

Expressioni

Inductioni

Expressed under normal conditions, its expression can further be increased after various stress treatments.

Gene expression databases

BgeeiENSG00000137094.
CleanExiHS_DNAJB5.
ExpressionAtlasiO75953. baseline and differential.
GenevisibleiO75953. HS.

Organism-specific databases

HPAiHPA023818.
HPA050794.

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

  • chaperone binding Source: UniProtKB
  • unfolded protein binding Source: InterPro

Protein-protein interaction databases

BioGridi117350. 35 interactors.
IntActiO75953. 16 interactors.
MINTiMINT-6733004.
STRINGi9606.ENSP00000404079.

Structurei

3D structure databases

ProteinModelPortaliO75953.
SMRiO75953.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 68JPROSITE-ProRule annotationAdd BLAST65

Phylogenomic databases

eggNOGiKOG0714. Eukaryota.
COG0484. LUCA.
GeneTreeiENSGT00760000118947.
HOGENOMiHOG000226718.
HOVERGENiHBG066727.
InParanoidiO75953.
KOiK09511.
OMAiGRTMVVE.
OrthoDBiEOG091G0DLS.
PhylomeDBiO75953.
TreeFamiTF105141.

Family and domain databases

CDDicd06257. DnaJ. 1 hit.
Gene3Di1.10.287.110. 1 hit.
InterProiView protein in InterPro
IPR002939. DnaJ_C.
IPR036869. DnaJ_dom_sf.
IPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
IPR008971. HSP40/DnaJ_pept-bd.
PfamiView protein in Pfam
PF00226. DnaJ. 1 hit.
PF01556. DnaJ_C. 1 hit.
PRINTSiPR00625. JDOMAIN.
SMARTiView protein in SMART
SM00271. DnaJ. 1 hit.
SUPFAMiSSF46565. SSF46565. 1 hit.
SSF49493. SSF49493. 2 hits.
PROSITEiView protein in PROSITE
PS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75953-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKDYYKILG IPSGANEDEI KKAYRKMALK YHPDKNKEPN AEEKFKEIAE
60 70 80 90 100
AYDVLSDPKK RGLYDQYGEE GLKTGGGTSG GSSGSFHYTF HGDPHATFAS
110 120 130 140 150
FFGGSNPFDI FFASSRSTRP FSGFDPDDMD VDEDEDPFGA FGRFGFNGLS
160 170 180 190 200
RGPRRAPEPL YPRRKVQDPP VVHELRVSLE EIYHGSTKRM KITRRRLNPD
210 220 230 240 250
GRTVRTEDKI LHIVIKRGWK EGTKITFPKE GDATPDNIPA DIVFVLKDKP
260 270 280 290 300
HAHFRRDGTN VLYSALISLK EALCGCTVNI PTIDGRVIPL PCNDVIKPGT
310 320 330 340
VKRLRGEGLP FPKVPTQRGD LIVEFKVRFP DRLTPQTRQI LKQHLPCS
Length:348
Mass (Da):39,133
Last modified:November 1, 1998 - v1
Checksum:iDC9FE45DE4FD8CFC
GO
Isoform 2 (identifier: O75953-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFKRTVLSCPPPAAPPLQARGAFRSFPHSWGEDFLASLMFKIQLEPLKLRAWTLNGFVKFRNKETSAGPVAVM

Show »
Length:420
Mass (Da):47,175
Checksum:i946F7B3E1D71BFB2
GO
Isoform 3 (identifier: O75953-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGAEAEPWG...ETSAGPVAVM

Note: Gene prediction based on EST data.
Show »
Length:462
Mass (Da):51,689
Checksum:iB5F3CFA21A956470
GO

Sequence cautioni

The sequence AAH12115 differs from that shown. Unlikely isoform. Aberrant splice sites.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti190 – 196MKITRRR → IEDHKAS in AAM10498 (Ref. 2) Curated7
Sequence conflicti234 – 235TP → HL in AAM10498 (Ref. 2) Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0462231M → MFKRTVLSCPPPAAPPLQAR GAFRSFPHSWGEDFLASLMF KIQLEPLKLRAWTLNGFVKF RNKETSAGPVAVM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0472501M → MGGAEAEPWGRAPGPAIGGR RAGDSCPGWRRRSRSRGRGQ RLSHGPRRRPQLLTAAPPLQ ARGAFRSFPHSWGEDFLASL MFKIQLEPLKLRAWTLNGFV KFRNKETSAGPVAVM in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF088982 mRNA. Translation: AAC35860.1.
AF087870 mRNA. Translation: AAM10498.1.
AK023253 mRNA. Translation: BAG51176.1.
AK299647 mRNA. Translation: BAG61568.1.
AL355377 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58407.1.
BC012115 mRNA. Translation: AAH12115.1. Sequence problems.
CCDSiCCDS35007.1. [O75953-3]
CCDS47959.1. [O75953-4]
CCDS47960.2. [O75953-5]
RefSeqiNP_001128476.2. NM_001135004.2. [O75953-5]
NP_001128477.1. NM_001135005.2. [O75953-4]
NP_036398.3. NM_012266.5. [O75953-3]
XP_005251485.1. XM_005251428.3. [O75953-3]
XP_006716814.1. XM_006716751.2. [O75953-3]
XP_011516144.1. XM_011517842.2. [O75953-4]
UniGeneiHs.237506.

Genome annotation databases

EnsembliENST00000312316; ENSP00000312517; ENSG00000137094. [O75953-3]
ENST00000453597; ENSP00000404079; ENSG00000137094. [O75953-5]
ENST00000454002; ENSP00000413684; ENSG00000137094. [O75953-4]
ENST00000545841; ENSP00000441999; ENSG00000137094. [O75953-3]
GeneIDi25822.
KEGGihsa:25822.
UCSCiuc003zvs.5. human. [O75953-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDNJB5_HUMAN
AccessioniPrimary (citable) accession number: O75953
Secondary accession number(s): B3KN14
, B4DSA6, J3KQM9, J3KR08, Q5T656, Q8TDR7, Q96EM4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: November 1, 1998
Last modified: October 25, 2017
This is version 140 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot