Reviewed,
UniProtKB/Swiss-Prot O75900 (MMP23_HUMAN)
Last modified
November 25, 2008.
Version 59.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Matrix metalloproteinase-23 Short name=MMP-23 EC=3.4.24.- Alternative name(s): Matrix metallopeptidase 21 Short name=MMP-21 Matrix metalloprotease 22 Short name=MMP-22 Femalysin MIFR-1 Cleaved into the following chain: 1- Recommended name: Matrix metalloproteinase-23, soluble form | |||||||||
| Gene names |
| |||||||||
| Organism | Homo sapiens (Human) | |||||||||
| Taxonomic identifier | 9606 [NCBI] | |||||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 390 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Protease. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Enzyme regulation | Inhibited by TIMP2 By similarity. |
| Subcellular location | Membrane; Single-pass type II membrane protein. Cytoplasm › perinuclear region. Note= A secreted form produced by proteolytic cleavage seems also to exist Probable. |
| Tissue specificity | Predominantly expressed in ovary, testis and prostate. |
| Post-translational modification | N-glycosylated. Proteolytic cleavage might yield an active form By similarity. |
| Sequence similarities | Belongs to the peptidase M10A family. Contains 1 Ig-like C2-type (immunoglobulin-like) domain. |
| Sequence caution | The sequence CAM12836.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Signal-anchor Transmembrane |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase Metalloprotease Protease |
| PTM | Cleavage on pair of basic residues Glycoprotein Zymogen |
Gene Ontology (GO) | |
| Biological process | proteolysis Ref.2 Inferred from direct assay. Source: UniProtKB reproduction Ref.2Inferred from expression pattern. Source: UniProtKB |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-KW integral to membraneInferred from electronic annotation. Source: UniProtKB-KW proteinaceous extracellular matrix Ref.1Non-traceable author statement. Source: UniProtKB |
| Molecular function | metalloendopeptidase activity Ref.1 Ref.2 Inferred from direct assay. Source: UniProtKB zinc ion binding Ref.2Non-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75900-1) Also known as: MMP21/22A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75900-2) Also known as: MMP21/22B; The sequence of this isoform differs from the canonical sequence as follows: 199-199: G → GDRPGSSWRPLLCSTVGCRGRALGQTAGGTFRGGGCHWSLAG | ||||||
| Isoform 3 (identifier: O75900-3) Also known as: MMP21/22C; The sequence of this isoform differs from the canonical sequence as follows: 254-254: G → GESLCRAGGRGPGGPEPGVLPTLPIG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 390 | 390 | Matrix metalloproteinase-23 | PRO_0000259513 | |||||||
| Propeptide | 1 – 78 | 78 | Potential | PRO_0000259514 | |||||||
| Chain | 79 – 390 | 312 | Matrix metalloproteinase-23, soluble form | PRO_0000259515 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 19 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 20 – 40 | 21 | Signal-anchor for type II membrane protein Potential | ||||||||
| Topological domain | 41 – 390 | 350 | Extracellular Potential | ||||||||
| Domain | 295 – 380 | 86 | Ig-like C2-type | ||||||||
Sites | |||||||||||
| Active site | 212 | 1 | By similarity | ||||||||
| Metal binding | 211 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 215 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 221 | 1 | Zinc; catalytic By similarity | ||||||||
| Site | 78 – 79 | 2 | Cleavage; by furin-like protease Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 92 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 148 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 232 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 316 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 321 ↔ 370 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 199 | 1 | G → GDRPGSSWRPLLCSTVGCRG RALGQTAGGTFRGGGCHWSL AG in isoform 2. | VSP_021411 | |||||||
| Alternative sequence | 254 | 1 | G → GESLCRAGGRGPGGPEPGVL PTLPIG in isoform 3. | VSP_021412 | |||||||
| Natural variant | 91 | 1 | F → L: dbSNP rs1139033. | VAR_028948 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 78 | 1 | R → G: Abolishes processing of soluble form | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of two novel metalloproteinase genes linked to the Cdc2L locus on human chromosome 1p36.3." Gururajan R., Grenet J., Lahti J.M., Kidd V.J. Genomics 52:101-106(1998) [PubMed: 9740677] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3), VARIANT LEU-91. |
| [2] | "Cloning and characterization of human MMP-23, a new matrix metalloproteinase predominantly expressed in reproductive tissues and lacking conserved domains in other family members." Velasco G., Pendas A.M., Fueyo A., Knaueper V., Murphy G., Lopez-Otin C. J. Biol. Chem. 274:4570-4576(1999) [PubMed: 9988691] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Ovary. |
| [3] | "Cloning and characterization of a rat ortholog of MMP-23 (matrix metalloproteinase-23), a unique type of membrane-anchored matrix metalloproteinase and conditioned switching of its expression during the ovarian follicular development." Ohnishi J., Ohnishi E., Jin M., Hirano W., Nakane D., Matsui H., Kimura A., Sawa H., Nakayama K., Shibuya H., Nagashima K., Takahashi T. Mol. Endocrinol. 15:747-764(2001) [PubMed: 11328856] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), GLYCOSYLATION, SUBCELLULAR LOCATION, MUTAGENESIS OF ARG-78. Tissue: Uterus. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pancreas. |
Cross-references
Sequence databases | |
|---|---|
| AF055334 Genomic DNA. Translation: AAC63527.1. AF055334 Genomic DNA. Translation: AAC63528.1. AF055334 Genomic DNA. Translation: AAC63529.1. AF056200 mRNA. Translation: AAC62616.1. AF057061 mRNA. Translation: AAC62617.1. AF057062 mRNA. Translation: AAC62618.1. AJ005256 mRNA. Translation: CAB38176.1. AB031068 Genomic DNA. Translation: BAA92769.1. AB010961 mRNA. Translation: BAA24833.1. AL691432 Genomic DNA. Translation: CAM12835.1. AL691432 Genomic DNA. Translation: CAM12836.1. Sequence problems. BC025719 mRNA. Translation: AAH25719.1. | |
| RefSeq | NP_008914.1. |
| UniGene | Hs.192316 Hs.671760 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1HV5 based on UniProtKB Q02853. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | M10.022. |
PTM databases | |
| PhosphoSite | O75900. |
Genome annotation databases | |
| Ensembl | ENSG00000189409. Homo sapiens. [Contig view] |
| GeneID | 8510. |
| KEGG | hsa:8510. |
Organism-specific databases | |
| HGNC | HGNC:7170. MMP23A. HGNC:7171. MMP23B. |
| HPA | CAB002768. |
| MIM | 603320. gene. 603321. gene. |
| PharmGKB | PA30879. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOVERGEN | O75900. |
Gene expression databases | |
| CleanEx | HS_MMP21. |
| GermOnline | ENSG00000189409. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007110. Ig-like. IPR003599. Ig_sub. IPR001818. Pept_M10A_M12B. IPR006025. Pept_M_Zn_BS. IPR006026. Peptidase_M. IPR003582. ShK_toxin. [Graphical view] |
| Pfam | PF00413. Peptidase_M10. 1 hit. PF01549. ShK. 1 hit. [Graphical view] |
| PRINTS | PR00138. MATRIXIN. |
| SMART | SM00409. IG. 1 hit. SM00254. ShKT. 1 hit. SM00235. ZnMc. 1 hit. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 1 hit. PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 31851. |
| SOURCE | Search... |
Entry information
| Entry name | MMP23_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75900 Secondary accession number(s): A2AGN0 Q9UJK8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


