O75900 (MMP23_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Matrix metalloproteinase-23 Short name=MMP-23 EC=3.4.24.- Alternative name(s): Femalysin MIFR-1 Matrix metalloproteinase-21 Short name=MMP-21 Matrix metalloproteinase-22 Short name=MMP-22 Cleaved into the following chain: | |||||||||
| Gene names |
| |||||||||
| Organism | Homo sapiens (Human) [Reference proteome] | |||||||||
| Taxonomic identifier | 9606 [NCBI] | |||||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 390 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum By similarity. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Enzyme regulation | Inhibited by TIMP2 By similarity. |
| Subcellular location | Endoplasmic reticulum membrane; Single-pass type II membrane protein By similarity. Membrane; Single-pass type II membrane protein. Note: A secreted form produced by proteolytic cleavage may also exist Probable. Ref.3 |
| Tissue specificity | Predominantly expressed in ovary, testis and prostate. Ref.2 |
| Domain | The ShKT domain associates with, and blocks several potassium channels in the nanomolar to low micromolar range. The relative affinity is Kv1.6 > Kv1.3 > Kv1.1 = Kv3.2 > Kv1.4 By similarity. |
| Post-translational modification | N-glycosylated. Ref.3 Proteolytic cleavage might yield an active form By similarity. |
| Sequence similarities | Belongs to the peptidase M10A family. Contains 1 Ig-like C2-type (immunoglobulin-like) domain. Contains 1 ShKT domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75900-1) Also known as: MMP21/22A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75900-2) Also known as: MMP21/22B; The sequence of this isoform differs from the canonical sequence as follows: 199-199: G → GDRPGSSWRPLLCSTVGCRGRALGQTAGGTFRGGGCHWSLAG | ||||||
| Isoform 3 (identifier: O75900-3) Also known as: MMP21/22C; The sequence of this isoform differs from the canonical sequence as follows: 254-254: G → GESLCRAGGRGPGGPEPGVLPTLPIG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 390 | 390 | Matrix metalloproteinase-23 | PRO_0000259513 | |||||||
| Propeptide | 1 – 78 | 78 | Potential | PRO_0000259514 | |||||||
| Chain | 79 – 390 | 312 | Matrix metalloproteinase-23, soluble form | PRO_0000259515 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 19 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 20 – 40 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 41 – 390 | 350 | Lumenal Potential | ||||||||
| Domain | 255 – 289 | 35 | ShKT | ||||||||
| Domain | 295 – 380 | 86 | Ig-like C2-type | ||||||||
Sites | |||||||||||
| Active site | 212 | 1 | By similarity | ||||||||
| Metal binding | 211 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 215 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 221 | 1 | Zinc; catalytic By similarity | ||||||||
| Site | 78 – 79 | 2 | Cleavage; by furin-like protease Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 92 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 148 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 232 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 316 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 255 ↔ 289 | By similarity | |||||||||
| Disulfide bond | 262 ↔ 282 | By similarity | |||||||||
| Disulfide bond | 271 ↔ 286 | By similarity | |||||||||
| Disulfide bond | 321 ↔ 370 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 199 | 1 | G → GDRPGSSWRPLLCSTVGCRG RALGQTAGGTFRGGGCHWSL AG in isoform 2. | VSP_021411 | |||||||
| Alternative sequence | 254 | 1 | G → GESLCRAGGRGPGGPEPGVL PTLPIG in isoform 3. | VSP_021412 | |||||||
| Natural variant | 91 | 1 | F → L. Ref.1 Corresponds to variant rs1139033 [ dbSNP | Ensembl ]. | VAR_028948 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 78 | 1 | R → G: Abolishes processing of soluble form. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of two novel metalloproteinase genes linked to the Cdc2L locus on human chromosome 1p36.3." Gururajan R., Grenet J., Lahti J.M., Kidd V.J. Genomics 52:101-106(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3), VARIANT LEU-91. |
| [2] | "Cloning and characterization of human MMP-23, a new matrix metalloproteinase predominantly expressed in reproductive tissues and lacking conserved domains in other family members." Velasco G., Pendas A.M., Fueyo A., Knaueper V., Murphy G., Lopez-Otin C. J. Biol. Chem. 274:4570-4576(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Ovary. |
| [3] | "Cloning and characterization of a rat ortholog of MMP-23 (matrix metalloproteinase-23), a unique type of membrane-anchored matrix metalloproteinase and conditioned switching of its expression during the ovarian follicular development." Ohnishi J., Ohnishi E., Jin M., Hirano W., Nakane D., Matsui H., Kimura A., Sawa H., Nakayama K., Shibuya H., Nagashima K., Takahashi T. Mol. Endocrinol. 15:747-764(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), GLYCOSYLATION, SUBCELLULAR LOCATION, MUTAGENESIS OF ARG-78. Tissue: Uterus. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pancreas. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF055334 Genomic DNA. Translation: AAC63527.1. AF055334 Genomic DNA. Translation: AAC63528.1. AF055334 Genomic DNA. Translation: AAC63529.1. AF056200 mRNA. Translation: AAC62616.1. AF057061 mRNA. Translation: AAC62617.1. AF057062 mRNA. Translation: AAC62618.1. AJ005256 mRNA. Translation: CAB38176.1. AB031068 Genomic DNA. Translation: BAA92769.1. AB010961 mRNA. Translation: BAA24833.1. AL691432 Genomic DNA. No translation available. BC025719 mRNA. Translation: AAH25719.1. |
| IPI | IPI00012949. IPI00719650. IPI00783823. |
| RefSeq | NP_008914.1. NM_006983.1. |
| UniGene | Hs.192316. Hs.671760. |
3D structure databases | |
| ProteinModelPortal | O75900. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O75900. 1 interaction. |
Protein family/group databases | |
| MEROPS | M10.022. |
PTM databases | |
| PhosphoSite | O75900. |
Proteomic databases | |
| PaxDb | O75900. |
| PRIDE | O75900. |
Protocols and materials databases | |
| DNASU | 8510. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000356026; ENSP00000348308; ENSG00000189409. |
| GeneID | 8510. |
| KEGG | hsa:8510. |
| UCSC | uc001agp.3. human. |
Organism-specific databases | |
| CTD | 8510. |
| GeneCards | GC01P001559. GC01P001619. |
| H-InvDB | HIX0178039. |
| HGNC | HGNC:7170. MMP23A. HGNC:7171. MMP23B. |
| HPA | CAB002768. |
| MIM | 603320. gene. 603321. gene. |
| neXtProt | NX_O75900. |
| PharmGKB | PA30880. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG245056. |
| HOVERGEN | HBG053177. |
| InParanoid | O75900. |
| KO | K08001. |
| OrthoDB | EOG4RFKSV. |
Gene expression databases | |
| ArrayExpress | O75900. |
| Bgee | O75900. |
| CleanEx | HS_MMP21. |
| Genevestigator | O75900. |
| GermOnline | ENSG00000189409. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 1 hit. 3.40.390.10. 1 hit. |
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003599. Ig_sub. IPR024079. MetalloPept_cat_dom. IPR001818. Pept_M10_metallopeptidase. IPR021190. Pept_M10A. IPR006026. Peptidase_Metallo. IPR003582. ShK_toxin. [Graphical view] |
| Pfam | PF00413. Peptidase_M10. 1 hit. PF01549. ShK. 1 hit. [Graphical view] |
| PRINTS | PR00138. MATRIXIN. |
| SMART | SM00409. IG. 1 hit. SM00254. ShKT. 1 hit. SM00235. ZnMc. 1 hit. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 1 hit. PS51670. SHKT. 1 hit. PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 8510. |
| NextBio | 31851. |
| SOURCE | Search... |
Entry information
| Entry name | MMP23_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75900 Secondary accession number(s): A2AGN0 Q9UJK8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
