Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Matrix metalloproteinase-23

Gene

MMP23A

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum (By similarity).By similarity

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Enzyme regulationi

Inhibited by TIMP2.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi211Zinc; catalyticPROSITE-ProRule annotation1
Active sitei212PROSITE-ProRule annotation1
Metal bindingi215Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi221Zinc; catalyticPROSITE-ProRule annotation1

GO - Molecular functioni

  • metalloendopeptidase activity Source: UniProtKB
  • metallopeptidase activity Source: UniProtKB
  • zinc ion binding Source: UniProtKB

GO - Biological processi

  • proteolysis Source: UniProtKB
  • reproduction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM10.022.

Names & Taxonomyi

Protein namesi
Recommended name:
Matrix metalloproteinase-23 (EC:3.4.24.-)
Short name:
MMP-23
Alternative name(s):
Femalysin
MIFR-1
Matrix metalloproteinase-21
Short name:
MMP-21
Matrix metalloproteinase-22
Short name:
MMP-22
Cleaved into the following chain:
Gene namesi
Name:MMP23A
Synonyms:MMP21
AND
Name:MMP23B
Synonyms:MMP21, MMP22
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:7170. MMP23A.
HGNC:7171. MMP23B.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 19CytoplasmicSequence analysisAdd BLAST19
Transmembranei20 – 40Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini41 – 390LumenalSequence analysisAdd BLAST350

GO - Cellular componenti

  • endoplasmic reticulum membrane Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB-KW
  • intracellular Source: UniProtKB
  • proteinaceous extracellular matrix Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi78R → G: Abolishes processing of soluble form. 1 Publication1

Organism-specific databases

DisGeNETi8510.
8511.
OpenTargetsiENSG00000189409.
PharmGKBiPA30880.

Chemistry databases

DrugBankiDB00786. Marimastat.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002595131 – 390Matrix metalloproteinase-23Add BLAST390
PropeptideiPRO_00002595141 – 78Sequence analysisAdd BLAST78
ChainiPRO_000025951579 – 390Matrix metalloproteinase-23, soluble formAdd BLAST312

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi92N-linked (GlcNAc...)Sequence analysis1
Glycosylationi148N-linked (GlcNAc...)Sequence analysis1
Glycosylationi232N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi255 ↔ 289By similarity
Disulfide bondi262 ↔ 282By similarity
Disulfide bondi271 ↔ 286By similarity
Glycosylationi316N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi321 ↔ 370By similarity

Post-translational modificationi

N-glycosylated.1 Publication
Proteolytic cleavage might yield an active form.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei78 – 79Cleavage; by furin-like proteaseSequence analysis2

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

PaxDbiO75900.
PeptideAtlasiO75900.
PRIDEiO75900.

PTM databases

iPTMnetiO75900.
PhosphoSitePlusiO75900.

Expressioni

Tissue specificityi

Predominantly expressed in ovary, testis and prostate.1 Publication

Gene expression databases

BgeeiENSG00000189409.
CleanExiHS_MMP21.
ExpressionAtlasiO75900. baseline and differential.
GenevisibleiO75900. HS.

Organism-specific databases

HPAiCAB002768.

Interactioni

Protein-protein interaction databases

BioGridi114082. 2 interactors.
IntActiO75900. 1 interactor.
STRINGi9606.ENSP00000348308.

Structurei

3D structure databases

ProteinModelPortaliO75900.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini255 – 289ShKTPROSITE-ProRule annotationAdd BLAST35
Domaini295 – 380Ig-like C2-typeAdd BLAST86

Domaini

The ShKT domain associates with, and blocks several potassium channels in the nanomolar to low micromolar range. The relative affinity is Kv1.6 > Kv1.3 > Kv1.1 = Kv3.2 > Kv1.4 (By similarity).By similarity

Sequence similaritiesi

Belongs to the peptidase M10A family.Curated
Contains 1 ShKT domain.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1565. Eukaryota.
ENOG410XQ5D. LUCA.
GeneTreeiENSGT00860000133713.
HOVERGENiHBG053177.
InParanoidiO75900.
KOiK08001.
OMAiHCFDGIT.
OrthoDBiEOG091G03DP.
PhylomeDBiO75900.
TreeFamiTF315428.

Family and domain databases

CDDicd04278. ZnMc_MMP. 1 hit.
Gene3Di2.60.40.10. 1 hit.
3.40.390.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR033739. M10A_MMP.
IPR024079. MetalloPept_cat_dom.
IPR028687. MMP23.
IPR001818. Pept_M10_metallopeptidase.
IPR021190. Pept_M10A.
IPR006026. Peptidase_Metallo.
IPR003582. ShKT_dom.
[Graphical view]
PANTHERiPTHR10201:SF7. PTHR10201:SF7. 1 hit.
PfamiPF00413. Peptidase_M10. 1 hit.
PF01549. ShK. 1 hit.
[Graphical view]
PRINTSiPR00138. MATRIXIN.
SMARTiSM00409. IG. 1 hit.
SM00254. ShKT. 1 hit.
SM00235. ZnMc. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51670. SHKT. 1 hit.
PS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75900-1) [UniParc]FASTAAdd to basket
Also known as: MMP21/22A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGRGARVPSE APGAGVERRW LGAALVALCL LPALVLLARL GAPAVPAWSA
60 70 80 90 100
AQGDVAALGL SAVPPTRVPG PLAPRRRRYT LTPARLRWDH FNLTYRILSF
110 120 130 140 150
PRNLLSPRET RRALAAAFRM WSDVSPFSFR EVAPEQPSDL RIGFYPINHT
160 170 180 190 200
DCLVSALHHC FDGPTGELAH AFFPPHGGIH FDDSEYWVLG PTRYSWKKGV
210 220 230 240 250
WLTDLVHVAA HEIGHALGLM HSQHGRALMH LNATLRGWKA LSQDELWGLH
260 270 280 290 300
RLYGCLDRLF VCASWARRGF CDARRRLMKR LCPSSCDFCY EFPFPTVATT
310 320 330 340 350
PPPPRTKTRL VPEGRNVTFR CGQKILHKKG KVYWYKDQEP LEFSYPGYLA
360 370 380 390
LGEAHLSIIA NAVNEGTYTC VVRRQQRVLT TYSWRVRVRG
Length:390
Mass (Da):43,935
Last modified:October 31, 2006 - v2
Checksum:i5D78E4B4F2053D15
GO
Isoform 2 (identifier: O75900-2) [UniParc]FASTAAdd to basket
Also known as: MMP21/22B

The sequence of this isoform differs from the canonical sequence as follows:
     199-199: G → GDRPGSSWRPLLCSTVGCRGRALGQTAGGTFRGGGCHWSLAG

Show »
Length:431
Mass (Da):48,107
Checksum:i807BA712BA201EF1
GO
Isoform 3 (identifier: O75900-3) [UniParc]FASTAAdd to basket
Also known as: MMP21/22C

The sequence of this isoform differs from the canonical sequence as follows:
     254-254: G → GESLCRAGGRGPGGPEPGVLPTLPIG

Show »
Length:415
Mass (Da):46,305
Checksum:iCD428F3F07F226EB
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02894891F → L.1 PublicationCorresponds to variant rs1139033dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_021411199G → GDRPGSSWRPLLCSTVGCRG RALGQTAGGTFRGGGCHWSL AG in isoform 2. 1 Publication1
Alternative sequenceiVSP_021412254G → GESLCRAGGRGPGGPEPGVL PTLPIG in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF055334 Genomic DNA. Translation: AAC63527.1.
AF055334 Genomic DNA. Translation: AAC63528.1.
AF055334 Genomic DNA. Translation: AAC63529.1.
AF056200 mRNA. Translation: AAC62616.1.
AF057061 mRNA. Translation: AAC62617.1.
AF057062 mRNA. Translation: AAC62618.1.
AJ005256 mRNA. Translation: CAB38176.1.
AB031068 Genomic DNA. Translation: BAA92769.1.
AB010961 mRNA. Translation: BAA24833.1.
AL691432 Genomic DNA. No translation available.
BC025719 mRNA. Translation: AAH25719.1.
CCDSiCCDS30559.1. [O75900-1]
RefSeqiNP_008914.1. NM_006983.1. [O75900-1]
UniGeneiHs.192316.
Hs.671760.

Genome annotation databases

EnsembliENST00000356026; ENSP00000348308; ENSG00000189409. [O75900-1]
GeneIDi8510.
KEGGihsa:8510.
UCSCiuc001agp.4. human. [O75900-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF055334 Genomic DNA. Translation: AAC63527.1.
AF055334 Genomic DNA. Translation: AAC63528.1.
AF055334 Genomic DNA. Translation: AAC63529.1.
AF056200 mRNA. Translation: AAC62616.1.
AF057061 mRNA. Translation: AAC62617.1.
AF057062 mRNA. Translation: AAC62618.1.
AJ005256 mRNA. Translation: CAB38176.1.
AB031068 Genomic DNA. Translation: BAA92769.1.
AB010961 mRNA. Translation: BAA24833.1.
AL691432 Genomic DNA. No translation available.
BC025719 mRNA. Translation: AAH25719.1.
CCDSiCCDS30559.1. [O75900-1]
RefSeqiNP_008914.1. NM_006983.1. [O75900-1]
UniGeneiHs.192316.
Hs.671760.

3D structure databases

ProteinModelPortaliO75900.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114082. 2 interactors.
IntActiO75900. 1 interactor.
STRINGi9606.ENSP00000348308.

Chemistry databases

DrugBankiDB00786. Marimastat.

Protein family/group databases

MEROPSiM10.022.

PTM databases

iPTMnetiO75900.
PhosphoSitePlusiO75900.

Proteomic databases

PaxDbiO75900.
PeptideAtlasiO75900.
PRIDEiO75900.

Protocols and materials databases

DNASUi8510.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356026; ENSP00000348308; ENSG00000189409. [O75900-1]
GeneIDi8510.
KEGGihsa:8510.
UCSCiuc001agp.4. human. [O75900-1]

Organism-specific databases

CTDi8510.
DisGeNETi8510.
8511.
GeneCardsiMMP23A.
MMP23B.
H-InvDBHIX0178039.
HGNCiHGNC:7170. MMP23A.
HGNC:7171. MMP23B.
HPAiCAB002768.
MIMi603320. gene.
603321. gene.
neXtProtiNX_O75900.
OpenTargetsiENSG00000189409.
PharmGKBiPA30880.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1565. Eukaryota.
ENOG410XQ5D. LUCA.
GeneTreeiENSGT00860000133713.
HOVERGENiHBG053177.
InParanoidiO75900.
KOiK08001.
OMAiHCFDGIT.
OrthoDBiEOG091G03DP.
PhylomeDBiO75900.
TreeFamiTF315428.

Miscellaneous databases

GeneWikiiMMP23B.
GenomeRNAii8510.
PROiO75900.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000189409.
CleanExiHS_MMP21.
ExpressionAtlasiO75900. baseline and differential.
GenevisibleiO75900. HS.

Family and domain databases

CDDicd04278. ZnMc_MMP. 1 hit.
Gene3Di2.60.40.10. 1 hit.
3.40.390.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR033739. M10A_MMP.
IPR024079. MetalloPept_cat_dom.
IPR028687. MMP23.
IPR001818. Pept_M10_metallopeptidase.
IPR021190. Pept_M10A.
IPR006026. Peptidase_Metallo.
IPR003582. ShKT_dom.
[Graphical view]
PANTHERiPTHR10201:SF7. PTHR10201:SF7. 1 hit.
PfamiPF00413. Peptidase_M10. 1 hit.
PF01549. ShK. 1 hit.
[Graphical view]
PRINTSiPR00138. MATRIXIN.
SMARTiSM00409. IG. 1 hit.
SM00254. ShKT. 1 hit.
SM00235. ZnMc. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51670. SHKT. 1 hit.
PS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMMP23_HUMAN
AccessioniPrimary (citable) accession number: O75900
Secondary accession number(s): A2AGN0
, A2AGN1, O75894, O75895, Q5QPQ8, Q76P96, Q7LDM6, Q7LDM7, Q9UBR9, Q9UJK8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: November 30, 2016
This is version 136 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.