Reviewed,
UniProtKB/Swiss-Prot O75884 (RBBP9_HUMAN)
Last modified
November 4, 2008.
Version 67.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Retinoblastoma-binding protein 9 Short name=RBBP-9 Alternative name(s): Retinoblastoma-binding protein 10 Short name=RBBP-10 B5T overexpressed gene protein Short name=Bog protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 186 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1. |
| Subcellular location | |
| Tissue specificity | Widely expressed. Expressed at higher levels in tumor tissues than in normal tissues. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-KW nucleusInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75884-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75884-2) The sequence of this isoform differs from the canonical sequence as follows: 152-186: RLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA → SWTPNCTNSLTVVTFRTQSSMN | ||||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 186 | 186 | Retinoblastoma-binding protein 9 | PRO_0000097180 | |||||
Regions | |||||||||
| Region | 56 – 70 | 15 | Retinoblastoma protein binding Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 49 | 1 | Phosphothreonine; by CK2 Potential | ||||||
| Modified residue | 135 | 1 | Phosphoserine; by CK2 Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 152 – 186 | 35 | RLETK…LKVPA → SWTPNCTNSLTVVTFRTQSS MN in isoform 2. | VSP_004374 | |||||
Experimental info | |||||||||
| Mutagenesis | 63 | 1 | L → Q: Loss of retinoblastoma protein binding | ||||||
| Sequence conflict | 2 | 1 | A → V in AAC63498. Ref.1 | ||||||
| Sequence conflict | 13 – 14 | 2 | NG → KI in AAC63498. Ref.1 | ||||||
| Sequence conflict | 18 | 1 | V → E in AAC63498. Ref.1 | ||||||
| Sequence conflict | 93 – 94 | 2 | IV → LI in AAC63498. Ref.1 | ||||||
| Sequence conflict | 102 – 103 | 2 | DL → EF in AAC63498. Ref.1 | ||||||
| Sequence conflict | 115 | 1 | T → S in AAC63498. Ref.1 | ||||||
| Sequence conflict | 129 | 1 | Y → H in AAC63498. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A retinoblastoma-binding protein that affects cell-cycle control and confers transforming ability." Woitach J.T., Zhang M., Niu C.-H., Thorgeirsson S.S. Nat. Genet. 19:371-374(1998) [PubMed: 9697699] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), MUTAGENESIS OF LEU-63. |
| [2] | "Cloning and expression of a novel retinoblastoma binding protein cDNA, RBBP10." Chen J.-Z., Yang Q.-S., Wang S., Meng X.-F., Ying K., Xie Y., Mao Y.-M. Biochem. Genet. 40:273-282(2002) [PubMed: 12296629] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION. Tissue: Fetal brain. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 1). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF039564 mRNA. Translation: AAC63498.1. AF237576 mRNA. Translation: AAL83721.1. AL121893 Genomic DNA. Translation: CAC11112.1. BC015938 mRNA. Translation: AAH15938.1. | |||||||||||||
| RefSeq | NP_006597.2. | ||||||||||||
| UniGene | Hs.69330 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Proteomic databases | |||||||||||||
| PeptideAtlas | O75884. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000089050. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 10741. | ||||||||||||
| KEGG | hsa:10741. | ||||||||||||
Organism-specific databases | |||||||||||||
| H-InvDB | HIX0015668. HIX0043236. | ||||||||||||
| HGNC | HGNC:9892. RBBP9. | ||||||||||||
| HPA | HPA015830. | ||||||||||||
| MIM | 602908. gene. | ||||||||||||
| PharmGKB | PA34256. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
| GeneCards | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOGENOM | O75884. | ||||||||||||
| HOVERGEN | O75884. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O75884. | ||||||||||||
| CleanEx | HS_RBBP9. | ||||||||||||
| GermOnline | ENSG00000089050. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR010662. DUF1234. [Graphical view] | ||||||||||||
| Pfam | PF06821. DUF1234. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 40785. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RBBP9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75884 Secondary accession number(s): Q9H1D8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |

Clusters with


