Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O75840

- KLF7_HUMAN

UniProt

O75840 - KLF7_HUMAN

Protein

Krueppel-like factor 7

Gene

KLF7

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 119 (01 Oct 2014)
      Sequence version 1 (01 Nov 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcriptional activator. Binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri219 – 24325C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri249 – 27325C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri279 – 30123C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. sequence-specific DNA binding transcription factor activity Source: ProtInc
    3. transcription coactivator activity Source: ProtInc
    4. zinc ion binding Source: ProtInc

    GO - Biological processi

    1. axon guidance Source: Ensembl
    2. dendrite morphogenesis Source: Ensembl
    3. positive regulation of transcription, DNA-templated Source: Ensembl
    4. regulation of transcription from RNA polymerase II promoter Source: ProtInc
    5. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Krueppel-like factor 7
    Alternative name(s):
    Ubiquitous krueppel-like factor
    Gene namesi
    Name:KLF7
    Synonyms:UKLF
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:6350. KLF7.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30140.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 302302Krueppel-like factor 7PRO_0000047174Add
    BLAST

    Proteomic databases

    PaxDbiO75840.
    PRIDEiO75840.

    Expressioni

    Tissue specificityi

    Ubiquitous and highly expressed in brain and spinal cord in the adult, and in kidney and brain in the embryo.

    Gene expression databases

    ArrayExpressiO75840.
    BgeeiO75840.
    CleanExiHS_KLF7.
    GenevestigatoriO75840.

    Organism-specific databases

    HPAiHPA030490.

    Interactioni

    Protein-protein interaction databases

    BioGridi114168. 3 interactions.
    STRINGi9606.ENSP00000309570.

    Structurei

    3D structure databases

    ProteinModelPortaliO75840.
    SMRiO75840. Positions 219-301.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi215 – 2206Nuclear localization signalSequence Analysis

    Domaini

    The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

    Sequence similaritiesi

    Contains 3 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri219 – 24325C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri249 – 27325C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri279 – 30123C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOGENOMiHOG000231192.
    HOVERGENiHBG000836.
    InParanoidiO75840.
    KOiK09207.
    OMAiDLDCFLR.
    OrthoDBiEOG747PJ4.
    PhylomeDBiO75840.
    TreeFamiTF350556.

    Family and domain databases

    Gene3Di3.30.160.60. 3 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 3 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 3 hits.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O75840-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDVLASYSIF QELQLVHDTG YFSALPSLEE TWQQTCLELE RYLQTEPRRI    50
    SETFGEDLDC FLHASPPPCI EESFRRLDPL LLPVEAAICE KSSAVDILLS 100
    RDKLLSETCL SLQPASSSLD SYTAVNQAQL NAVTSLTPPS SPELSRHLVK 150
    TSQTLSAVDG TVTLKLVAKK AALSSVKVGG VATAAAAVTA AGAVKSGQSD 200
    SDQGGLGAEA CPENKKRVHR CQFNGCRKVY TKSSHLKAHQ RTHTGEKPYK 250
    CSWEGCEWRF ARSDELTRHY RKHTGAKPFK CNHCDRCFSR SDHLALHMKR 300
    HI 302
    Length:302
    Mass (Da):33,362
    Last modified:November 1, 1998 - v1
    Checksum:i95141CE3A42C5774
    GO
    Isoform 2 (identifier: O75840-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → M

    Show »
    Length:269
    Mass (Da):29,564
    Checksum:iDE6EE837FCE04A5F
    GO
    Isoform 3 (identifier: O75840-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         179-302: GGVATAAAAV...HLALHMKRHI → RSLISAHGRD...FPGLTILPST

    Show »
    Length:230
    Mass (Da):24,791
    Checksum:iDFAB0453E5564923
    GO
    Isoform 4 (identifier: O75840-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → MFPSWP

    Show »
    Length:274
    Mass (Da):30,178
    Checksum:i8EABCFD4A70D4A2F
    GO
    Isoform 5 (identifier: O75840-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         55-244: Missing.

    Show »
    Length:112
    Mass (Da):13,444
    Checksum:i261E2F7A6F586A33
    GO
    Isoform 6 (identifier: O75840-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         35-87: TCLELERYLQ...DPLLLPVEAA → VRSLISAHGR...FPGLTILPST
         88-302: Missing.

    Show »
    Length:87
    Mass (Da):9,295
    Checksum:i6C032F59FE36958F
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3434MDVLA…ETWQQ → M in isoform 2. 1 PublicationVSP_047030Add
    BLAST
    Alternative sequencei1 – 3434MDVLA…ETWQQ → MFPSWP in isoform 4. 1 PublicationVSP_047031Add
    BLAST
    Alternative sequencei35 – 8753TCLEL…PVEAA → VRSLISAHGRDVSGVLHEAM SSRGTTGNTQVQSPSNATTA TGVFPGLTILPST in isoform 6. 1 PublicationVSP_047477Add
    BLAST
    Alternative sequencei55 – 244190Missing in isoform 5. 1 PublicationVSP_047478Add
    BLAST
    Alternative sequencei88 – 302215Missing in isoform 6. 1 PublicationVSP_047479Add
    BLAST
    Alternative sequencei179 – 302124GGVAT…MKRHI → RSLISAHGRDVSGVLHEAMS SRGTTGNTQVQSPSNATTAT GVFPGLTILPST in isoform 3. 1 PublicationVSP_047032Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB015132 mRNA. Translation: BAA33521.1.
    HF546205 mRNA. Translation: CCO02791.1.
    HF546206 mRNA. Translation: CCO02792.1.
    BX537890 mRNA. Translation: CAD97885.1.
    CR542112 mRNA. Translation: CAG46909.1.
    AK297312 mRNA. Translation: BAH12543.1.
    AK314439 mRNA. Translation: BAG37050.1.
    AC007879 Genomic DNA. No translation available.
    AC008062 Genomic DNA. No translation available.
    CH471063 Genomic DNA. Translation: EAW70400.1.
    CH471063 Genomic DNA. Translation: EAW70402.1.
    CH471063 Genomic DNA. Translation: EAW70403.1.
    BC012919 mRNA. Translation: AAH12919.1.
    CCDSiCCDS2373.1. [O75840-1]
    CCDS59438.1. [O75840-4]
    CCDS59439.1. [O75840-3]
    CCDS59440.1. [O75840-2]
    RefSeqiNP_001257871.1. NM_001270942.1. [O75840-3]
    NP_001257872.1. NM_001270943.1. [O75840-2]
    NP_001257873.1. NM_001270944.1. [O75840-4]
    NP_003700.1. NM_003709.3. [O75840-1]
    UniGeneiHs.471221.
    Hs.59908.

    Genome annotation databases

    EnsembliENST00000309446; ENSP00000309570; ENSG00000118263. [O75840-1]
    ENST00000412414; ENSP00000403284; ENSG00000118263. [O75840-4]
    ENST00000421199; ENSP00000387510; ENSG00000118263. [O75840-2]
    ENST00000423015; ENSP00000398572; ENSG00000118263. [O75840-3]
    ENST00000458272; ENSP00000393268; ENSG00000118263. [O75840-5]
    GeneIDi8609.
    KEGGihsa:8609.
    UCSCiuc002vbz.2. human. [O75840-1]
    uc002vca.2. human.
    uc031rrb.1. human.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB015132 mRNA. Translation: BAA33521.1 .
    HF546205 mRNA. Translation: CCO02791.1 .
    HF546206 mRNA. Translation: CCO02792.1 .
    BX537890 mRNA. Translation: CAD97885.1 .
    CR542112 mRNA. Translation: CAG46909.1 .
    AK297312 mRNA. Translation: BAH12543.1 .
    AK314439 mRNA. Translation: BAG37050.1 .
    AC007879 Genomic DNA. No translation available.
    AC008062 Genomic DNA. No translation available.
    CH471063 Genomic DNA. Translation: EAW70400.1 .
    CH471063 Genomic DNA. Translation: EAW70402.1 .
    CH471063 Genomic DNA. Translation: EAW70403.1 .
    BC012919 mRNA. Translation: AAH12919.1 .
    CCDSi CCDS2373.1. [O75840-1 ]
    CCDS59438.1. [O75840-4 ]
    CCDS59439.1. [O75840-3 ]
    CCDS59440.1. [O75840-2 ]
    RefSeqi NP_001257871.1. NM_001270942.1. [O75840-3 ]
    NP_001257872.1. NM_001270943.1. [O75840-2 ]
    NP_001257873.1. NM_001270944.1. [O75840-4 ]
    NP_003700.1. NM_003709.3. [O75840-1 ]
    UniGenei Hs.471221.
    Hs.59908.

    3D structure databases

    ProteinModelPortali O75840.
    SMRi O75840. Positions 219-301.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114168. 3 interactions.
    STRINGi 9606.ENSP00000309570.

    Proteomic databases

    PaxDbi O75840.
    PRIDEi O75840.

    Protocols and materials databases

    DNASUi 8609.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000309446 ; ENSP00000309570 ; ENSG00000118263 . [O75840-1 ]
    ENST00000412414 ; ENSP00000403284 ; ENSG00000118263 . [O75840-4 ]
    ENST00000421199 ; ENSP00000387510 ; ENSG00000118263 . [O75840-2 ]
    ENST00000423015 ; ENSP00000398572 ; ENSG00000118263 . [O75840-3 ]
    ENST00000458272 ; ENSP00000393268 ; ENSG00000118263 . [O75840-5 ]
    GeneIDi 8609.
    KEGGi hsa:8609.
    UCSCi uc002vbz.2. human. [O75840-1 ]
    uc002vca.2. human.
    uc031rrb.1. human.

    Organism-specific databases

    CTDi 8609.
    GeneCardsi GC02M207909.
    HGNCi HGNC:6350. KLF7.
    HPAi HPA030490.
    MIMi 604865. gene.
    neXtProti NX_O75840.
    PharmGKBi PA30140.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOGENOMi HOG000231192.
    HOVERGENi HBG000836.
    InParanoidi O75840.
    KOi K09207.
    OMAi DLDCFLR.
    OrthoDBi EOG747PJ4.
    PhylomeDBi O75840.
    TreeFami TF350556.

    Miscellaneous databases

    ChiTaRSi KLF7. human.
    GeneWikii KLF7.
    GenomeRNAii 8609.
    NextBioi 32259.
    PROi O75840.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O75840.
    Bgeei O75840.
    CleanExi HS_KLF7.
    Genevestigatori O75840.

    Family and domain databases

    Gene3Di 3.30.160.60. 3 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 3 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning the cDNA for a new human zinc finger protein defines a group of closely related Krueppel-like transcription factors."
      Matsumoto N., Laub F., Aldabe R., Zhang W., Ramirez F., Yoshida T., Terada M.
      J. Biol. Chem. 273:28229-28237(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Shaking the family tree: Identification of novel and biologically active alternatively spliced isoforms across the KLF family of transcription factors."
      Camacho-Vanegas O., Till J., Miranda-Lorenzo I., Ozturk B., Camacho S.C., Martignetti J.A.
      FASEB J. 27:432-436(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 6), ALTERNATIVE SPLICING.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Heart.
    4. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
      Tissue: Placenta.
    6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Testis.

    Entry informationi

    Entry nameiKLF7_HUMAN
    AccessioniPrimary (citable) accession number: O75840
    Secondary accession number(s): B2RB03
    , B7Z4F7, C9JF04, E7EWH1, L0R4P2, Q7Z3H8, Q96E51
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: November 1, 1998
    Last modified: October 1, 2014
    This is version 119 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3