Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O75840 (KLF7_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 117. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Krueppel-like factor 7
Alternative name(s):
Ubiquitous krueppel-like factor
Gene names
Name:KLF7
Synonyms:UKLF
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length302 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Transcriptional activator. Binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence.

Subcellular location

Nucleus Probable.

Tissue specificity

Ubiquitous and highly expressed in brain and spinal cord in the adult, and in kidney and brain in the embryo.

Domain

The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Contains 3 C2H2-type zinc fingers.

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O75840-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O75840-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → M
Isoform 3 (identifier: O75840-3)

The sequence of this isoform differs from the canonical sequence as follows:
     179-302: GGVATAAAAV...HLALHMKRHI → RSLISAHGRD...FPGLTILPST
Isoform 4 (identifier: O75840-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → MFPSWP
Isoform 5 (identifier: O75840-5)

The sequence of this isoform differs from the canonical sequence as follows:
     55-244: Missing.
Isoform 6 (identifier: O75840-6)

The sequence of this isoform differs from the canonical sequence as follows:
     35-87: TCLELERYLQ...DPLLLPVEAA → VRSLISAHGR...FPGLTILPST
     88-302: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 302302Krueppel-like factor 7
PRO_0000047174

Regions

Zinc finger219 – 24325C2H2-type 1
Zinc finger249 – 27325C2H2-type 2
Zinc finger279 – 30123C2H2-type 3
Motif215 – 2206Nuclear localization signal Potential

Natural variations

Alternative sequence1 – 3434MDVLA…ETWQQ → M in isoform 2.
VSP_047030
Alternative sequence1 – 3434MDVLA…ETWQQ → MFPSWP in isoform 4.
VSP_047031
Alternative sequence35 – 8753TCLEL…PVEAA → VRSLISAHGRDVSGVLHEAM SSRGTTGNTQVQSPSNATTA TGVFPGLTILPST in isoform 6.
VSP_047477
Alternative sequence55 – 244190Missing in isoform 5.
VSP_047478
Alternative sequence88 – 302215Missing in isoform 6.
VSP_047479
Alternative sequence179 – 302124GGVAT…MKRHI → RSLISAHGRDVSGVLHEAMS SRGTTGNTQVQSPSNATTAT GVFPGLTILPST in isoform 3.
VSP_047032

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1998. Version 1.
Checksum: 95141CE3A42C5774

FASTA30233,362
        10         20         30         40         50         60 
MDVLASYSIF QELQLVHDTG YFSALPSLEE TWQQTCLELE RYLQTEPRRI SETFGEDLDC 

        70         80         90        100        110        120 
FLHASPPPCI EESFRRLDPL LLPVEAAICE KSSAVDILLS RDKLLSETCL SLQPASSSLD 

       130        140        150        160        170        180 
SYTAVNQAQL NAVTSLTPPS SPELSRHLVK TSQTLSAVDG TVTLKLVAKK AALSSVKVGG 

       190        200        210        220        230        240 
VATAAAAVTA AGAVKSGQSD SDQGGLGAEA CPENKKRVHR CQFNGCRKVY TKSSHLKAHQ 

       250        260        270        280        290        300 
RTHTGEKPYK CSWEGCEWRF ARSDELTRHY RKHTGAKPFK CNHCDRCFSR SDHLALHMKR 


HI 

« Hide

Isoform 2 [UniParc].

Checksum: DE6EE837FCE04A5F
Show »

FASTA26929,564
Isoform 3 [UniParc].

Checksum: DFAB0453E5564923
Show »

FASTA23024,791
Isoform 4 [UniParc].

Checksum: 8EABCFD4A70D4A2F
Show »

FASTA27430,178
Isoform 5 [UniParc].

Checksum: 261E2F7A6F586A33
Show »

FASTA11213,444
Isoform 6 [UniParc].

Checksum: 6C032F59FE36958F
Show »

FASTA879,295

References

« Hide 'large scale' references
[1]"Cloning the cDNA for a new human zinc finger protein defines a group of closely related Krueppel-like transcription factors."
Matsumoto N., Laub F., Aldabe R., Zhang W., Ramirez F., Yoshida T., Terada M.
J. Biol. Chem. 273:28229-28237(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Shaking the family tree: Identification of novel and biologically active alternatively spliced isoforms across the KLF family of transcription factors."
Camacho-Vanegas O., Till J., Miranda-Lorenzo I., Ozturk B., Camacho S.C., Martignetti J.A.
FASEB J. 27:432-436(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 6), ALTERNATIVE SPLICING.
[3]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Heart.
[4]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
Tissue: Placenta.
[6]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Testis.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB015132 mRNA. Translation: BAA33521.1.
HF546205 mRNA. Translation: CCO02791.1.
HF546206 mRNA. Translation: CCO02792.1.
BX537890 mRNA. Translation: CAD97885.1.
CR542112 mRNA. Translation: CAG46909.1.
AK297312 mRNA. Translation: BAH12543.1.
AK314439 mRNA. Translation: BAG37050.1.
AC007879 Genomic DNA. No translation available.
AC008062 Genomic DNA. No translation available.
CH471063 Genomic DNA. Translation: EAW70400.1.
CH471063 Genomic DNA. Translation: EAW70402.1.
CH471063 Genomic DNA. Translation: EAW70403.1.
BC012919 mRNA. Translation: AAH12919.1.
CCDSCCDS2373.1. [O75840-1]
CCDS59438.1. [O75840-4]
CCDS59439.1. [O75840-3]
CCDS59440.1. [O75840-2]
RefSeqNP_001257871.1. NM_001270942.1. [O75840-3]
NP_001257872.1. NM_001270943.1. [O75840-2]
NP_001257873.1. NM_001270944.1. [O75840-4]
NP_003700.1. NM_003709.3. [O75840-1]
UniGeneHs.471221.
Hs.59908.

3D structure databases

ProteinModelPortalO75840.
SMRO75840. Positions 219-301.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114168. 3 interactions.
STRING9606.ENSP00000309570.

Proteomic databases

PaxDbO75840.
PRIDEO75840.

Protocols and materials databases

DNASU8609.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000309446; ENSP00000309570; ENSG00000118263. [O75840-1]
ENST00000412414; ENSP00000403284; ENSG00000118263. [O75840-4]
ENST00000421199; ENSP00000387510; ENSG00000118263. [O75840-2]
ENST00000423015; ENSP00000398572; ENSG00000118263. [O75840-3]
ENST00000458272; ENSP00000393268; ENSG00000118263. [O75840-5]
GeneID8609.
KEGGhsa:8609.
UCSCuc002vbz.2. human. [O75840-1]
uc002vca.2. human.

Organism-specific databases

CTD8609.
GeneCardsGC02M207909.
HGNCHGNC:6350. KLF7.
HPAHPA030490.
MIM604865. gene.
neXtProtNX_O75840.
PharmGKBPA30140.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOGENOMHOG000231192.
HOVERGENHBG000836.
InParanoidO75840.
KOK09207.
OMADLDCFLR.
OrthoDBEOG747PJ4.
PhylomeDBO75840.
TreeFamTF350556.

Gene expression databases

ArrayExpressO75840.
BgeeO75840.
CleanExHS_KLF7.
GenevestigatorO75840.

Family and domain databases

Gene3D3.30.160.60. 3 hits.
InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSKLF7. human.
GeneWikiKLF7.
GenomeRNAi8609.
NextBio32259.
PROO75840.
SOURCESearch...

Entry information

Entry nameKLF7_HUMAN
AccessionPrimary (citable) accession number: O75840
Secondary accession number(s): B2RB03 expand/collapse secondary AC list , B7Z4F7, C9JF04, E7EWH1, L0R4P2, Q7Z3H8, Q96E51
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: July 9, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM