Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Krueppel-like factor 7

Gene

KLF7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Transcriptional activator. Binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri219 – 243C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri249 – 273C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri279 – 301C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • transcription coactivator activity Source: ProtInc
  • transcription factor activity, sequence-specific DNA binding Source: ProtInc
  • zinc ion binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000118263-MONOMER.
SIGNORiO75840.

Names & Taxonomyi

Protein namesi
Recommended name:
Krueppel-like factor 7
Alternative name(s):
Ubiquitous krueppel-like factor
Gene namesi
Name:KLF7
Synonyms:UKLF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:6350. KLF7.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi8609.
OpenTargetsiENSG00000118263.
PharmGKBiPA30140.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000471741 – 302Krueppel-like factor 7Add BLAST302

Proteomic databases

MaxQBiO75840.
PaxDbiO75840.
PeptideAtlasiO75840.
PRIDEiO75840.

PTM databases

iPTMnetiO75840.
PhosphoSitePlusiO75840.

Expressioni

Tissue specificityi

Ubiquitous and highly expressed in brain and spinal cord in the adult, and in kidney and brain in the embryo.

Gene expression databases

BgeeiENSG00000118263.
CleanExiHS_KLF7.
ExpressionAtlasiO75840. baseline and differential.
GenevisibleiO75840. HS.

Organism-specific databases

HPAiHPA030490.

Interactioni

Protein-protein interaction databases

BioGridi114168. 2 interactors.
STRINGi9606.ENSP00000309570.

Structurei

3D structure databases

ProteinModelPortaliO75840.
SMRiO75840.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi215 – 220Nuclear localization signalSequence analysis6

Domaini

The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

Sequence similaritiesi

Contains 3 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri219 – 243C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri249 – 273C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri279 – 301C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000118998.
HOGENOMiHOG000231192.
HOVERGENiHBG000836.
InParanoidiO75840.
KOiK09207.
OMAiDLDCFLR.
OrthoDBiEOG091G1BN0.
PhylomeDBiO75840.
TreeFamiTF350556.

Family and domain databases

Gene3Di3.30.160.60. 3 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75840-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVLASYSIF QELQLVHDTG YFSALPSLEE TWQQTCLELE RYLQTEPRRI
60 70 80 90 100
SETFGEDLDC FLHASPPPCI EESFRRLDPL LLPVEAAICE KSSAVDILLS
110 120 130 140 150
RDKLLSETCL SLQPASSSLD SYTAVNQAQL NAVTSLTPPS SPELSRHLVK
160 170 180 190 200
TSQTLSAVDG TVTLKLVAKK AALSSVKVGG VATAAAAVTA AGAVKSGQSD
210 220 230 240 250
SDQGGLGAEA CPENKKRVHR CQFNGCRKVY TKSSHLKAHQ RTHTGEKPYK
260 270 280 290 300
CSWEGCEWRF ARSDELTRHY RKHTGAKPFK CNHCDRCFSR SDHLALHMKR

HI
Length:302
Mass (Da):33,362
Last modified:November 1, 1998 - v1
Checksum:i95141CE3A42C5774
GO
Isoform 2 (identifier: O75840-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → M

Show »
Length:269
Mass (Da):29,564
Checksum:iDE6EE837FCE04A5F
GO
Isoform 3 (identifier: O75840-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     179-302: GGVATAAAAV...HLALHMKRHI → RSLISAHGRD...FPGLTILPST

Show »
Length:230
Mass (Da):24,791
Checksum:iDFAB0453E5564923
GO
Isoform 4 (identifier: O75840-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → MFPSWP

Show »
Length:274
Mass (Da):30,178
Checksum:i8EABCFD4A70D4A2F
GO
Isoform 5 (identifier: O75840-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-244: Missing.

Show »
Length:112
Mass (Da):13,444
Checksum:i261E2F7A6F586A33
GO
Isoform 6 (identifier: O75840-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-87: TCLELERYLQ...DPLLLPVEAA → VRSLISAHGR...FPGLTILPST
     88-302: Missing.

Show »
Length:87
Mass (Da):9,295
Checksum:i6C032F59FE36958F
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0470301 – 34MDVLA…ETWQQ → M in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_0470311 – 34MDVLA…ETWQQ → MFPSWP in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_04747735 – 87TCLEL…PVEAA → VRSLISAHGRDVSGVLHEAM SSRGTTGNTQVQSPSNATTA TGVFPGLTILPST in isoform 6. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_04747855 – 244Missing in isoform 5. 1 PublicationAdd BLAST190
Alternative sequenceiVSP_04747988 – 302Missing in isoform 6. 1 PublicationAdd BLAST215
Alternative sequenceiVSP_047032179 – 302GGVAT…MKRHI → RSLISAHGRDVSGVLHEAMS SRGTTGNTQVQSPSNATTAT GVFPGLTILPST in isoform 3. 1 PublicationAdd BLAST124

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015132 mRNA. Translation: BAA33521.1.
HF546205 mRNA. Translation: CCO02791.1.
HF546206 mRNA. Translation: CCO02792.1.
BX537890 mRNA. Translation: CAD97885.1.
CR542112 mRNA. Translation: CAG46909.1.
AK297312 mRNA. Translation: BAH12543.1.
AK314439 mRNA. Translation: BAG37050.1.
AC007879 Genomic DNA. No translation available.
AC008062 Genomic DNA. No translation available.
CH471063 Genomic DNA. Translation: EAW70400.1.
CH471063 Genomic DNA. Translation: EAW70402.1.
CH471063 Genomic DNA. Translation: EAW70403.1.
BC012919 mRNA. Translation: AAH12919.1.
CCDSiCCDS2373.1. [O75840-1]
CCDS59438.1. [O75840-4]
CCDS59439.1. [O75840-3]
CCDS59440.1. [O75840-2]
RefSeqiNP_001257871.1. NM_001270942.1. [O75840-3]
NP_001257872.1. NM_001270943.1. [O75840-2]
NP_001257873.1. NM_001270944.1. [O75840-4]
NP_003700.1. NM_003709.3. [O75840-1]
XP_016860650.1. XM_017005161.1. [O75840-1]
XP_016860653.1. XM_017005164.1. [O75840-3]
UniGeneiHs.471221.
Hs.59908.

Genome annotation databases

EnsembliENST00000309446; ENSP00000309570; ENSG00000118263. [O75840-1]
ENST00000412414; ENSP00000403284; ENSG00000118263. [O75840-4]
ENST00000421199; ENSP00000387510; ENSG00000118263. [O75840-2]
ENST00000423015; ENSP00000398572; ENSG00000118263. [O75840-3]
ENST00000458272; ENSP00000393268; ENSG00000118263. [O75840-5]
GeneIDi8609.
KEGGihsa:8609.
UCSCiuc002vbz.3. human. [O75840-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015132 mRNA. Translation: BAA33521.1.
HF546205 mRNA. Translation: CCO02791.1.
HF546206 mRNA. Translation: CCO02792.1.
BX537890 mRNA. Translation: CAD97885.1.
CR542112 mRNA. Translation: CAG46909.1.
AK297312 mRNA. Translation: BAH12543.1.
AK314439 mRNA. Translation: BAG37050.1.
AC007879 Genomic DNA. No translation available.
AC008062 Genomic DNA. No translation available.
CH471063 Genomic DNA. Translation: EAW70400.1.
CH471063 Genomic DNA. Translation: EAW70402.1.
CH471063 Genomic DNA. Translation: EAW70403.1.
BC012919 mRNA. Translation: AAH12919.1.
CCDSiCCDS2373.1. [O75840-1]
CCDS59438.1. [O75840-4]
CCDS59439.1. [O75840-3]
CCDS59440.1. [O75840-2]
RefSeqiNP_001257871.1. NM_001270942.1. [O75840-3]
NP_001257872.1. NM_001270943.1. [O75840-2]
NP_001257873.1. NM_001270944.1. [O75840-4]
NP_003700.1. NM_003709.3. [O75840-1]
XP_016860650.1. XM_017005161.1. [O75840-1]
XP_016860653.1. XM_017005164.1. [O75840-3]
UniGeneiHs.471221.
Hs.59908.

3D structure databases

ProteinModelPortaliO75840.
SMRiO75840.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114168. 2 interactors.
STRINGi9606.ENSP00000309570.

PTM databases

iPTMnetiO75840.
PhosphoSitePlusiO75840.

Proteomic databases

MaxQBiO75840.
PaxDbiO75840.
PeptideAtlasiO75840.
PRIDEiO75840.

Protocols and materials databases

DNASUi8609.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309446; ENSP00000309570; ENSG00000118263. [O75840-1]
ENST00000412414; ENSP00000403284; ENSG00000118263. [O75840-4]
ENST00000421199; ENSP00000387510; ENSG00000118263. [O75840-2]
ENST00000423015; ENSP00000398572; ENSG00000118263. [O75840-3]
ENST00000458272; ENSP00000393268; ENSG00000118263. [O75840-5]
GeneIDi8609.
KEGGihsa:8609.
UCSCiuc002vbz.3. human. [O75840-1]

Organism-specific databases

CTDi8609.
DisGeNETi8609.
GeneCardsiKLF7.
HGNCiHGNC:6350. KLF7.
HPAiHPA030490.
MIMi604865. gene.
neXtProtiNX_O75840.
OpenTargetsiENSG00000118263.
PharmGKBiPA30140.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000118998.
HOGENOMiHOG000231192.
HOVERGENiHBG000836.
InParanoidiO75840.
KOiK09207.
OMAiDLDCFLR.
OrthoDBiEOG091G1BN0.
PhylomeDBiO75840.
TreeFamiTF350556.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000118263-MONOMER.
SIGNORiO75840.

Miscellaneous databases

ChiTaRSiKLF7. human.
GeneWikiiKLF7.
GenomeRNAii8609.
PROiO75840.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000118263.
CleanExiHS_KLF7.
ExpressionAtlasiO75840. baseline and differential.
GenevisibleiO75840. HS.

Family and domain databases

Gene3Di3.30.160.60. 3 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKLF7_HUMAN
AccessioniPrimary (citable) accession number: O75840
Secondary accession number(s): B2RB03
, B7Z4F7, C9JF04, E7EWH1, L0R4P2, Q7Z3H8, Q96E51
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: November 2, 2016
This is version 135 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.