Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75840

- KLF7_HUMAN

UniProt

O75840 - KLF7_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Krueppel-like factor 7

Gene

KLF7

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Transcriptional activator. Binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri219 – 24325C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri249 – 27325C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri279 – 30123C2H2-type 3PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. sequence-specific DNA binding transcription factor activity Source: ProtInc
  3. transcription coactivator activity Source: ProtInc
  4. zinc ion binding Source: ProtInc

GO - Biological processi

  1. axon guidance Source: Ensembl
  2. dendrite morphogenesis Source: Ensembl
  3. positive regulation of transcription, DNA-templated Source: Ensembl
  4. regulation of transcription from RNA polymerase II promoter Source: ProtInc
  5. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Krueppel-like factor 7
Alternative name(s):
Ubiquitous krueppel-like factor
Gene namesi
Name:KLF7
Synonyms:UKLF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:6350. KLF7.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30140.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 302302Krueppel-like factor 7PRO_0000047174Add
BLAST

Proteomic databases

PaxDbiO75840.
PRIDEiO75840.

Expressioni

Tissue specificityi

Ubiquitous and highly expressed in brain and spinal cord in the adult, and in kidney and brain in the embryo.

Gene expression databases

BgeeiO75840.
CleanExiHS_KLF7.
ExpressionAtlasiO75840. baseline and differential.
GenevestigatoriO75840.

Organism-specific databases

HPAiHPA030490.

Interactioni

Protein-protein interaction databases

BioGridi114168. 3 interactions.
STRINGi9606.ENSP00000309570.

Structurei

3D structure databases

ProteinModelPortaliO75840.
SMRiO75840. Positions 219-301.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi215 – 2206Nuclear localization signalSequence Analysis

Domaini

The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

Sequence similaritiesi

Contains 3 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri219 – 24325C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri249 – 27325C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri279 – 30123C2H2-type 3PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00760000118998.
HOGENOMiHOG000231192.
HOVERGENiHBG000836.
InParanoidiO75840.
KOiK09207.
OMAiDLDCFLR.
OrthoDBiEOG747PJ4.
PhylomeDBiO75840.
TreeFamiTF350556.

Family and domain databases

Gene3Di3.30.160.60. 3 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O75840-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVLASYSIF QELQLVHDTG YFSALPSLEE TWQQTCLELE RYLQTEPRRI
60 70 80 90 100
SETFGEDLDC FLHASPPPCI EESFRRLDPL LLPVEAAICE KSSAVDILLS
110 120 130 140 150
RDKLLSETCL SLQPASSSLD SYTAVNQAQL NAVTSLTPPS SPELSRHLVK
160 170 180 190 200
TSQTLSAVDG TVTLKLVAKK AALSSVKVGG VATAAAAVTA AGAVKSGQSD
210 220 230 240 250
SDQGGLGAEA CPENKKRVHR CQFNGCRKVY TKSSHLKAHQ RTHTGEKPYK
260 270 280 290 300
CSWEGCEWRF ARSDELTRHY RKHTGAKPFK CNHCDRCFSR SDHLALHMKR

HI
Length:302
Mass (Da):33,362
Last modified:November 1, 1998 - v1
Checksum:i95141CE3A42C5774
GO
Isoform 2 (identifier: O75840-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → M

Show »
Length:269
Mass (Da):29,564
Checksum:iDE6EE837FCE04A5F
GO
Isoform 3 (identifier: O75840-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     179-302: GGVATAAAAV...HLALHMKRHI → RSLISAHGRD...FPGLTILPST

Show »
Length:230
Mass (Da):24,791
Checksum:iDFAB0453E5564923
GO
Isoform 4 (identifier: O75840-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → MFPSWP

Show »
Length:274
Mass (Da):30,178
Checksum:i8EABCFD4A70D4A2F
GO
Isoform 5 (identifier: O75840-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-244: Missing.

Show »
Length:112
Mass (Da):13,444
Checksum:i261E2F7A6F586A33
GO
Isoform 6 (identifier: O75840-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-87: TCLELERYLQ...DPLLLPVEAA → VRSLISAHGR...FPGLTILPST
     88-302: Missing.

Show »
Length:87
Mass (Da):9,295
Checksum:i6C032F59FE36958F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3434MDVLA…ETWQQ → M in isoform 2. 1 PublicationVSP_047030Add
BLAST
Alternative sequencei1 – 3434MDVLA…ETWQQ → MFPSWP in isoform 4. 1 PublicationVSP_047031Add
BLAST
Alternative sequencei35 – 8753TCLEL…PVEAA → VRSLISAHGRDVSGVLHEAM SSRGTTGNTQVQSPSNATTA TGVFPGLTILPST in isoform 6. 1 PublicationVSP_047477Add
BLAST
Alternative sequencei55 – 244190Missing in isoform 5. 1 PublicationVSP_047478Add
BLAST
Alternative sequencei88 – 302215Missing in isoform 6. 1 PublicationVSP_047479Add
BLAST
Alternative sequencei179 – 302124GGVAT…MKRHI → RSLISAHGRDVSGVLHEAMS SRGTTGNTQVQSPSNATTAT GVFPGLTILPST in isoform 3. 1 PublicationVSP_047032Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015132 mRNA. Translation: BAA33521.1.
HF546205 mRNA. Translation: CCO02791.1.
HF546206 mRNA. Translation: CCO02792.1.
BX537890 mRNA. Translation: CAD97885.1.
CR542112 mRNA. Translation: CAG46909.1.
AK297312 mRNA. Translation: BAH12543.1.
AK314439 mRNA. Translation: BAG37050.1.
AC007879 Genomic DNA. No translation available.
AC008062 Genomic DNA. No translation available.
CH471063 Genomic DNA. Translation: EAW70400.1.
CH471063 Genomic DNA. Translation: EAW70402.1.
CH471063 Genomic DNA. Translation: EAW70403.1.
BC012919 mRNA. Translation: AAH12919.1.
CCDSiCCDS2373.1. [O75840-1]
CCDS59438.1. [O75840-4]
CCDS59439.1. [O75840-3]
CCDS59440.1. [O75840-2]
RefSeqiNP_001257871.1. NM_001270942.1. [O75840-3]
NP_001257872.1. NM_001270943.1. [O75840-2]
NP_001257873.1. NM_001270944.1. [O75840-4]
NP_003700.1. NM_003709.3. [O75840-1]
UniGeneiHs.471221.
Hs.59908.

Genome annotation databases

EnsembliENST00000309446; ENSP00000309570; ENSG00000118263. [O75840-1]
ENST00000412414; ENSP00000403284; ENSG00000118263. [O75840-4]
ENST00000421199; ENSP00000387510; ENSG00000118263. [O75840-2]
ENST00000423015; ENSP00000398572; ENSG00000118263. [O75840-3]
ENST00000458272; ENSP00000393268; ENSG00000118263. [O75840-5]
GeneIDi8609.
KEGGihsa:8609.
UCSCiuc002vbz.2. human. [O75840-1]
uc002vca.2. human.
uc031rrb.1. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015132 mRNA. Translation: BAA33521.1 .
HF546205 mRNA. Translation: CCO02791.1 .
HF546206 mRNA. Translation: CCO02792.1 .
BX537890 mRNA. Translation: CAD97885.1 .
CR542112 mRNA. Translation: CAG46909.1 .
AK297312 mRNA. Translation: BAH12543.1 .
AK314439 mRNA. Translation: BAG37050.1 .
AC007879 Genomic DNA. No translation available.
AC008062 Genomic DNA. No translation available.
CH471063 Genomic DNA. Translation: EAW70400.1 .
CH471063 Genomic DNA. Translation: EAW70402.1 .
CH471063 Genomic DNA. Translation: EAW70403.1 .
BC012919 mRNA. Translation: AAH12919.1 .
CCDSi CCDS2373.1. [O75840-1 ]
CCDS59438.1. [O75840-4 ]
CCDS59439.1. [O75840-3 ]
CCDS59440.1. [O75840-2 ]
RefSeqi NP_001257871.1. NM_001270942.1. [O75840-3 ]
NP_001257872.1. NM_001270943.1. [O75840-2 ]
NP_001257873.1. NM_001270944.1. [O75840-4 ]
NP_003700.1. NM_003709.3. [O75840-1 ]
UniGenei Hs.471221.
Hs.59908.

3D structure databases

ProteinModelPortali O75840.
SMRi O75840. Positions 219-301.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114168. 3 interactions.
STRINGi 9606.ENSP00000309570.

Proteomic databases

PaxDbi O75840.
PRIDEi O75840.

Protocols and materials databases

DNASUi 8609.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000309446 ; ENSP00000309570 ; ENSG00000118263 . [O75840-1 ]
ENST00000412414 ; ENSP00000403284 ; ENSG00000118263 . [O75840-4 ]
ENST00000421199 ; ENSP00000387510 ; ENSG00000118263 . [O75840-2 ]
ENST00000423015 ; ENSP00000398572 ; ENSG00000118263 . [O75840-3 ]
ENST00000458272 ; ENSP00000393268 ; ENSG00000118263 . [O75840-5 ]
GeneIDi 8609.
KEGGi hsa:8609.
UCSCi uc002vbz.2. human. [O75840-1 ]
uc002vca.2. human.
uc031rrb.1. human.

Organism-specific databases

CTDi 8609.
GeneCardsi GC02M207909.
HGNCi HGNC:6350. KLF7.
HPAi HPA030490.
MIMi 604865. gene.
neXtProti NX_O75840.
PharmGKBi PA30140.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
GeneTreei ENSGT00760000118998.
HOGENOMi HOG000231192.
HOVERGENi HBG000836.
InParanoidi O75840.
KOi K09207.
OMAi DLDCFLR.
OrthoDBi EOG747PJ4.
PhylomeDBi O75840.
TreeFami TF350556.

Miscellaneous databases

ChiTaRSi KLF7. human.
GeneWikii KLF7.
GenomeRNAii 8609.
NextBioi 32259.
PROi O75840.
SOURCEi Search...

Gene expression databases

Bgeei O75840.
CleanExi HS_KLF7.
ExpressionAtlasi O75840. baseline and differential.
Genevestigatori O75840.

Family and domain databases

Gene3Di 3.30.160.60. 3 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 3 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning the cDNA for a new human zinc finger protein defines a group of closely related Krueppel-like transcription factors."
    Matsumoto N., Laub F., Aldabe R., Zhang W., Ramirez F., Yoshida T., Terada M.
    J. Biol. Chem. 273:28229-28237(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Shaking the family tree: Identification of novel and biologically active alternatively spliced isoforms across the KLF family of transcription factors."
    Camacho-Vanegas O., Till J., Miranda-Lorenzo I., Ozturk B., Camacho S.C., Martignetti J.A.
    FASEB J. 27:432-436(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 6), ALTERNATIVE SPLICING.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Heart.
  4. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    Tissue: Placenta.
  6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.

Entry informationi

Entry nameiKLF7_HUMAN
AccessioniPrimary (citable) accession number: O75840
Secondary accession number(s): B2RB03
, B7Z4F7, C9JF04, E7EWH1, L0R4P2, Q7Z3H8, Q96E51
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: October 29, 2014
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3