Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Eukaryotic translation initiation factor 3 subunit J

Gene

EIF3J

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773).2 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionInitiation factor
Biological processProtein biosynthesis

Enzyme and pathway databases

ReactomeiR-HSA-156827 L13a-mediated translational silencing of Ceruloplasmin expression
R-HSA-72649 Translation initiation complex formation
R-HSA-72689 Formation of a pool of free 40S subunits
R-HSA-72695 Formation of the ternary complex, and subsequently, the 43S complex
R-HSA-72702 Ribosomal scanning and start codon recognition
R-HSA-72706 GTP hydrolysis and joining of the 60S ribosomal subunit

Names & Taxonomyi

Protein namesi
Recommended name:
Eukaryotic translation initiation factor 3 subunit JUniRule annotation
Short name:
eIF3jUniRule annotation
Alternative name(s):
Eukaryotic translation initiation factor 3 subunit 1UniRule annotation
eIF-3-alphaUniRule annotation
eIF3 p35UniRule annotation
Gene namesi
Name:EIF3JUniRule annotation
Synonyms:EIF3S1UniRule annotation
ORF Names:PRO0391
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000104131.12
HGNCiHGNC:3270 EIF3J
MIMi603910 gene
neXtProtiNX_O75822

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi8669
OpenTargetsiENSG00000104131
PharmGKBiPA162384902

Polymorphism and mutation databases

BioMutaiEIF3J

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedUniRule annotationCombined sources2 Publications
ChainiPRO_00001235062 – 258Eukaryotic translation initiation factor 3 subunit JAdd BLAST257

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineUniRule annotationCombined sources2 Publications1
Modified residuei11PhosphoserineUniRule annotationCombined sources1 Publication1
Modified residuei13PhosphoserineUniRule annotationCombined sources1 Publication1
Modified residuei20PhosphoserineUniRule annotation1 Publication1
Cross-linki106Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei109PhosphothreonineUniRule annotationCombined sources1 Publication1
Modified residuei127PhosphoserineCombined sources1
Modified residuei254PhosphotyrosineCombined sources1

Post-translational modificationi

Phosphorylated. Phosphorylation is enhanced upon serum stimulation.UniRule annotation1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiO75822
MaxQBiO75822
PaxDbiO75822
PeptideAtlasiO75822
PRIDEiO75822

PTM databases

iPTMnetiO75822
PhosphoSitePlusiO75822
SwissPalmiO75822

Miscellaneous databases

PMAP-CutDBO75822

Expressioni

Gene expression databases

BgeeiENSG00000104131
CleanExiHS_EIF3J
ExpressionAtlasiO75822 baseline and differential
GenevisibleiO75822 HS

Organism-specific databases

HPAiHPA050977

Interactioni

Subunit structurei

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is composed of 13 subunits: EIF3A, EIF3B, EIF3C, EIF3D, EIF3E, EIF3F, EIF3G, EIF3H, EIF3I, EIF3J, EIF3K, EIF3L and EIF3M. The eIF-3 complex appears to include 3 stable modules: module A is composed of EIF3A, EIF3B, EIF3G and EIF3I; module B is composed of EIF3F, EIF3H, and EIF3M; and module C is composed of EIF3C, EIF3D, EIF3E, EIF3K and EIF3L. EIF3C of module C binds EIF3B of module A and EIF3H of module B, thereby linking the three modules. EIF3J is a labile subunit that binds to the eIF-3 complex via EIF3B. The eIF-3 complex interacts with RPS6KB1 under conditions of nutrient depletion. Mitogenic stimulation leads to binding and activation of a complex composed of MTOR and RPTOR, leading to phosphorylation and release of RPS6KB1 and binding of EIF4B to eIF-3.UniRule annotation8 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi114218, 38 interactors
CORUMiO75822
DIPiDIP-31117N
IntActiO75822, 29 interactors
MINTiO75822
STRINGi9606.ENSP00000261868

Structurei

Secondary structure

1258
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni145 – 147Combined sources3
Helixi153 – 167Combined sources15
Helixi168 – 170Combined sources3
Helixi176 – 188Combined sources13
Helixi193 – 212Combined sources20

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KRBNMR-B45-55[»]
3BPJX-ray1.85A/B/C/D141-220[»]
ProteinModelPortaliO75822
SMRiO75822
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75822

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni2 – 69Sufficient for interaction with EIF3BAdd BLAST68
Regioni243 – 258Promotes stable association with the 40S ribosomeAdd BLAST16

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili70 – 135UniRule annotationAdd BLAST66

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi2 – 8Poly-Ala7
Compositional biasi29 – 32Poly-Gly4
Compositional biasi53 – 57Poly-Asp5
Compositional biasi218 – 224Poly-Lys7

Sequence similaritiesi

Belongs to the eIF-3 subunit J family.UniRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4813 Eukaryota
ENOG4111U5G LUCA
GeneTreeiENSGT00390000018400
HOGENOMiHOG000048982
InParanoidiO75822
KOiK03245
OMAiMPPKKWD
OrthoDBiEOG091G141O
PhylomeDBiO75822
TreeFamiTF101514

Family and domain databases

Gene3Di1.10.246.60, 1 hit
HAMAPiMF_03009 eIF3j, 1 hit
InterProiView protein in InterPro
IPR023194 eIF3-like_dom_sf
IPR013906 eIF3j
PANTHERiPTHR21681 PTHR21681, 1 hit
PfamiView protein in Pfam
PF08597 eIF3_subunit, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75822-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAAAAAGD SDSWDADAFS VEDPVRKVGG GGTAGGDRWE GEDEDEDVKD
60 70 80 90 100
NWDDDDDEKK EEAEVKPEVK ISEKKKIAEK IKEKERQQKK RQEEIKKRLE
110 120 130 140 150
EPEEPKVLTP EEQLADKLRL KKLQEESDLE LAKETFGVNN AVYGIDAMNP
160 170 180 190 200
SSRDDFTEFG KLLKDKITQY EKSLYYASFL EVLVRDVCIS LEIDDLKKIT
210 220 230 240 250
NSLTVLCSEK QKQEKQSKAK KKKKGVVPGG GLKATMKDDL ADYGGYDGGY

VQDYEDFM
Length:258
Mass (Da):29,062
Last modified:September 19, 2002 - v2
Checksum:i83624235424445AA
GO
Isoform 2 (identifier: O75822-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-191: GVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISL → V

Note: No experimental confirmation available.
Show »
Length:204
Mass (Da):22,941
Checksum:iB2F463EE48927284
GO
Isoform 3 (identifier: O75822-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-98: Missing.

Note: No experimental confirmation available.
Show »
Length:209
Mass (Da):23,027
Checksum:iCA7D79180C47F1A0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti40E → G in AAC78729 (PubMed:9822659).Curated1

Mass spectrometryi

Molecular mass is 29293.2 Da from positions 1 - 258. 1 Publication
Molecular mass is 28974.2±0.3 Da from positions 1 - 258. Determined by MALDI. 1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034007141A → T1 PublicationCorresponds to variant dbSNP:rs2303578Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05477650 – 98Missing in isoform 3. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_054593137 – 191GVNNA…VCISL → V in isoform 2. 1 PublicationAdd BLAST55

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U97670 mRNA Translation: AAC78729.1
AK023388 mRNA Translation: BAB14555.1
AK300659 mRNA Translation: BAG62345.1
CR606839 mRNA No translation available.
AC009996 Genomic DNA No translation available.
BC002719 mRNA Translation: AAH02719.1
AF090923 mRNA Translation: AAF24039.1
CCDSiCCDS10111.1 [O75822-1]
CCDS61612.1 [O75822-2]
CCDS61613.1 [O75822-3]
RefSeqiNP_001271264.1, NM_001284335.1 [O75822-2]
NP_001271265.1, NM_001284336.1 [O75822-3]
NP_003749.2, NM_003758.3 [O75822-1]
UniGeneiHs.404056

Genome annotation databases

EnsembliENST00000261868; ENSP00000261868; ENSG00000104131 [O75822-1]
ENST00000424492; ENSP00000414548; ENSG00000104131 [O75822-3]
ENST00000535391; ENSP00000440221; ENSG00000104131 [O75822-2]
GeneIDi8669
KEGGihsa:8669
UCSCiuc001ztv.4 human [O75822-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiEIF3J_HUMAN
AccessioniPrimary (citable) accession number: O75822
Secondary accession number(s): B4DUI3
, F5H425, Q9BUD2, Q9H8Q2, Q9UI65
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: September 19, 2002
Last modified: March 28, 2018
This is version 179 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health