Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger MYND domain-containing protein 10

Gene

ZMYND10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for motile ciliary function. Probably involved in axonemal assembly of inner and outer dynein arms (IDA and ODA, respectively) for proper axoneme building for cilia motility. May act by indirectly regulating transcription of dynein proteins.2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri394 – 43037MYND-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

  • inner dynein arm assembly Source: UniProtKB
  • motile cilium assembly Source: UniProtKB
  • outer dynein arm assembly Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger MYND domain-containing protein 10
Alternative name(s):
Protein BLu
Gene namesi
Name:ZMYND10
Synonyms:BLU
ORF Names:LUCA12.4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:19412. ZMYND10.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Involvement in diseasei

Ciliary dyskinesia, primary, 22 (CILD22)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia. Patients may exhibit randomization of left-right body asymmetry and situs inversus, due to dysfunction of monocilia at the embryonic node. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome.
See also OMIM:615444
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti16 – 161V → G in CILD22. 2 Publications
Corresponds to variant rs138815960 [ dbSNP | Ensembl ].
VAR_070184
Natural varianti29 – 291S → P in CILD22. 1 Publication
Corresponds to variant rs587621539 [ dbSNP | Ensembl ].
VAR_070185
Natural varianti39 – 391L → P in CILD22. 1 Publication
VAR_070186
Natural varianti266 – 2661L → P in CILD22. 1 Publication
Corresponds to variant rs200913791 [ dbSNP | Ensembl ].
VAR_070187
Natural varianti379 – 3791Y → C in CILD22. 1 Publication
Corresponds to variant rs753061612 [ dbSNP | Ensembl ].
VAR_070189

Keywords - Diseasei

Ciliopathy, Disease mutation, Primary ciliary dyskinesia

Organism-specific databases

MalaCardsiZMYND10.
MIMi615444. phenotype.
Orphaneti244. Primary ciliary dyskinesia.
PharmGKBiPA134981649.

Polymorphism and mutation databases

BioMutaiZMYND10.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 440440Zinc finger MYND domain-containing protein 10PRO_0000218314Add
BLAST

Proteomic databases

PaxDbiO75800.
PeptideAtlasiO75800.
PRIDEiO75800.

PTM databases

PhosphoSiteiO75800.

Expressioni

Gene expression databases

BgeeiO75800.
CleanExiHS_ZMYND10.
ExpressionAtlasiO75800. baseline and differential.
GenevisibleiO75800. HS.

Organism-specific databases

HPAiHPA035255.

Interactioni

Subunit structurei

Interacts with LRRC6.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CDR1P518613EBI-747061,EBI-2836538
IFT43Q96FT93EBI-747061,EBI-10189681
NUTM1Q86Y263EBI-747061,EBI-10178410
TSC22D4Q9Y3Q85EBI-747061,EBI-739485

Protein-protein interaction databases

BioGridi119499. 9 interactions.
IntActiO75800. 7 interactions.
MINTiMINT-1476511.
STRINGi9606.ENSP00000231749.

Structurei

Secondary structure

1
440
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi395 – 3973Combined sources
Turni406 – 4083Combined sources
Beta strandi411 – 4155Combined sources
Helixi416 – 4216Combined sources
Helixi423 – 4297Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2D8QNMR-A384-440[»]
2DANNMR-A384-430[»]
ProteinModelPortaliO75800.
SMRiO75800. Positions 384-440.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75800.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni366 – 44075Interaction with LRRC6Add
BLAST

Sequence similaritiesi

Belongs to the ZMYND10 family.Curated
Contains 1 MYND-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri394 – 43037MYND-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiENOG410IIFT. Eukaryota.
ENOG410Z083. LUCA.
GeneTreeiENSGT00390000010195.
HOGENOMiHOG000007333.
HOVERGENiHBG055814.
InParanoidiO75800.
OMAiFEISLKA.
OrthoDBiEOG71ZP1S.
PhylomeDBiO75800.
TreeFamiTF324215.

Family and domain databases

InterProiIPR017333. UCP037948_Znf-MYND.
IPR002893. Znf_MYND.
[Graphical view]
PfamiPF01753. zf-MYND. 1 hit.
[Graphical view]
PIRSFiPIRSF037948. UCP037948_Znf_MYND10. 1 hit.
PROSITEiPS01360. ZF_MYND_1. 1 hit.
PS50865. ZF_MYND_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75800-1) [UniParc]FASTAAdd to basket

Also known as: Lung

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGDLELLLPG EAEVLVRGLR SFPLREMGSE GWNQQHENLE KLNMQAILDA
60 70 80 90 100
TVSQGEPIQE LLVTHGKVPT LVEELIAVEM WKQKVFPVFC RVEDFKPQNT
110 120 130 140 150
FPIYMVVHHE ASIINLLETV FFHKEVCESA EDTVLDLVDY CHRKLTLLVA
160 170 180 190 200
QSGCGGPPEG EGSQDSNPMQ ELQKQAELME FEIALKALSV LRYITDCVDS
210 220 230 240 250
LSLSTLSRML STHNLPCLLV ELLEHSPWSR REGGKLQQFE GSRWHTVAPS
260 270 280 290 300
EQQKLSKLDG QVWIALYNLL LSPEAQARYC LTSFAKGRLL KLRAFLTDTL
310 320 330 340 350
LDQLPNLAHL QSFLAHLTLT ETQPPKKDLV LEQIPEIWER LERENRGKWQ
360 370 380 390 400
AIAKHQLQHV FSPSEQDLRL QARRWAETYR LDVLEAVAPE RPRCAYCSAE
410 420 430 440
ASKRCSRCQN EWYCCRECQV KHWEKHGKTC VLAAQGDRAK
Length:440
Mass (Da):50,344
Last modified:November 8, 2002 - v2
Checksum:i510D41074C956CA3
GO
Isoform 2 (identifier: O75800-2) [UniParc]FASTAAdd to basket

Also known as: Testis

The sequence of this isoform differs from the canonical sequence as follows:
     200-234: SLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGG → RQWSVSQPPQLAHLKRIQRLHPVCWFLSPG

Show »
Length:435
Mass (Da):49,989
Checksum:i8E4A85DD7782C5D3
GO

Sequence cautioni

The sequence AAB67311.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti35 – 351Q → R in CAD38688 (PubMed:17974005).Curated
Sequence conflicti82 – 821K → E in BAG53316 (PubMed:14702039).Curated
Sequence conflicti134 – 1341V → A in BAD97063 (Ref. 4) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti16 – 161V → G in CILD22. 2 Publications
Corresponds to variant rs138815960 [ dbSNP | Ensembl ].
VAR_070184
Natural varianti29 – 291S → P in CILD22. 1 Publication
Corresponds to variant rs587621539 [ dbSNP | Ensembl ].
VAR_070185
Natural varianti39 – 391L → P in CILD22. 1 Publication
VAR_070186
Natural varianti266 – 2661L → P in CILD22. 1 Publication
Corresponds to variant rs200913791 [ dbSNP | Ensembl ].
VAR_070187
Natural varianti369 – 3691R → W.1 Publication
Corresponds to variant rs142613783 [ dbSNP | Ensembl ].
VAR_070188
Natural varianti379 – 3791Y → C in CILD22. 1 Publication
Corresponds to variant rs753061612 [ dbSNP | Ensembl ].
VAR_070189
Natural varianti407 – 4071R → Q in non-small cell lung cancer cell lines. 1 Publication
Corresponds to variant rs182064110 [ dbSNP | Ensembl ].
VAR_014227

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei200 – 23435SLSLS…RREGG → RQWSVSQPPQLAHLKRIQRL HPVCWFLSPG in isoform 2. 1 PublicationVSP_003328Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U70824 mRNA. Translation: AAC24726.1.
U70880 mRNA. Translation: AAC24728.1.
AL833828 mRNA. Translation: CAD38688.1.
AK096525 mRNA. Translation: BAG53316.1.
AK223343 mRNA. Translation: BAD97063.1.
AC002481 Genomic DNA. Translation: AAB67311.1. Sequence problems.
CH471055 Genomic DNA. Translation: EAW65104.1.
BC033732 mRNA. Translation: AAH33732.1.
CCDSiCCDS2825.1. [O75800-1]
CCDS77747.1. [O75800-2]
RefSeqiNP_001295308.1. NM_001308379.1. [O75800-2]
NP_056980.2. NM_015896.3. [O75800-1]
UniGeneiHs.526735.
Hs.627171.

Genome annotation databases

EnsembliENST00000231749; ENSP00000231749; ENSG00000004838. [O75800-1]
ENST00000360165; ENSP00000353289; ENSG00000004838. [O75800-2]
GeneIDi51364.
KEGGihsa:51364.
UCSCiuc003dag.2. human. [O75800-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U70824 mRNA. Translation: AAC24726.1.
U70880 mRNA. Translation: AAC24728.1.
AL833828 mRNA. Translation: CAD38688.1.
AK096525 mRNA. Translation: BAG53316.1.
AK223343 mRNA. Translation: BAD97063.1.
AC002481 Genomic DNA. Translation: AAB67311.1. Sequence problems.
CH471055 Genomic DNA. Translation: EAW65104.1.
BC033732 mRNA. Translation: AAH33732.1.
CCDSiCCDS2825.1. [O75800-1]
CCDS77747.1. [O75800-2]
RefSeqiNP_001295308.1. NM_001308379.1. [O75800-2]
NP_056980.2. NM_015896.3. [O75800-1]
UniGeneiHs.526735.
Hs.627171.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2D8QNMR-A384-440[»]
2DANNMR-A384-430[»]
ProteinModelPortaliO75800.
SMRiO75800. Positions 384-440.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119499. 9 interactions.
IntActiO75800. 7 interactions.
MINTiMINT-1476511.
STRINGi9606.ENSP00000231749.

PTM databases

PhosphoSiteiO75800.

Polymorphism and mutation databases

BioMutaiZMYND10.

Proteomic databases

PaxDbiO75800.
PeptideAtlasiO75800.
PRIDEiO75800.

Protocols and materials databases

DNASUi51364.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000231749; ENSP00000231749; ENSG00000004838. [O75800-1]
ENST00000360165; ENSP00000353289; ENSG00000004838. [O75800-2]
GeneIDi51364.
KEGGihsa:51364.
UCSCiuc003dag.2. human. [O75800-1]

Organism-specific databases

CTDi51364.
GeneCardsiZMYND10.
HGNCiHGNC:19412. ZMYND10.
HPAiHPA035255.
MalaCardsiZMYND10.
MIMi607070. gene.
615444. phenotype.
neXtProtiNX_O75800.
Orphaneti244. Primary ciliary dyskinesia.
PharmGKBiPA134981649.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IIFT. Eukaryota.
ENOG410Z083. LUCA.
GeneTreeiENSGT00390000010195.
HOGENOMiHOG000007333.
HOVERGENiHBG055814.
InParanoidiO75800.
OMAiFEISLKA.
OrthoDBiEOG71ZP1S.
PhylomeDBiO75800.
TreeFamiTF324215.

Miscellaneous databases

EvolutionaryTraceiO75800.
GeneWikiiZMYND10.
GenomeRNAii51364.
PROiO75800.
SOURCEiSearch...

Gene expression databases

BgeeiO75800.
CleanExiHS_ZMYND10.
ExpressionAtlasiO75800. baseline and differential.
GenevisibleiO75800. HS.

Family and domain databases

InterProiIPR017333. UCP037948_Znf-MYND.
IPR002893. Znf_MYND.
[Graphical view]
PfamiPF01753. zf-MYND. 1 hit.
[Graphical view]
PIRSFiPIRSF037948. UCP037948_Znf_MYND10. 1 hit.
PROSITEiPS01360. ZF_MYND_1. 1 hit.
PS50865. ZF_MYND_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A novel gene (BLu) that resides in the lung cancer region on chromosome 3p21.3 has the MYND Zn finger-like module."
    Duh F.-M., Latif F., Bader S., Sekido Y., Kuzmin I., Minna J.D., Koonin E., Lerman M.I.
    Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT TRP-369.
    Tissue: Lung and Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  5. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  8. "The 630-kb lung cancer homozygous deletion region on human chromosome 3p21.3: identification and evaluation of the resident candidate tumor suppressor genes."
    The international lung cancer chromosome 3p21.3 tumor suppressor gene consortium
    Lerman M.I., Minna J.D.
    Cancer Res. 60:6116-6133(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISCUSSION OF SEQUENCE, VARIANT GLN-407.
  9. "Solution structure of the MYND domain of the human zinc finger MYND domain-containing protein 10."
    RIKEN structural genomics initiative (RSGI)
    Submitted (JUN-2006) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 384-440.
  10. "ZMYND10 is mutated in primary ciliary dyskinesia and interacts with LRRC6."
    Zariwala M.A., Gee H.Y., Kurkowiak M., Al-Mutairi D.A., Leigh M.W., Hurd T.W., Hjeij R., Dell S.D., Chaki M., Dougherty G.W., Adan M., Spear P.C., Esteve-Rudd J., Loges N.T., Rosenfeld M., Diaz K.A., Olbrich H., Wolf W.E.
    , Sheridan E., Batten T.F., Halbritter J., Porath J.D., Kohl S., Lovric S., Hwang D.Y., Pittman J.E., Burns K.A., Ferkol T.W., Sagel S.D., Olivier K.N., Morgan L.C., Werner C., Raidt J., Pennekamp P., Sun Z., Zhou W., Airik R., Natarajan S., Allen S.J., Amirav I., Wieczorek D., Landwehr K., Nielsen K., Schwerk N., Sertic J., Kohler G., Washburn J., Levy S., Fan S., Koerner-Rettberg C., Amselem S., Williams D.S., Mitchell B.J., Drummond I.A., Otto E.A., Omran H., Knowles M.R., Hildebrandt F.
    Am. J. Hum. Genet. 93:336-345(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS CILD22 GLY-16; PRO-29 AND CYS-379, FUNCTION, INTERACTION WITH LRRC6.
  11. Cited for: VARIANTS CILD22 GLY-16; PRO-39 AND PRO-266, FUNCTION, INTERACTION WITH LRRC6.
  12. "Ciliary beat pattern and frequency in genetic variants of primary ciliary dyskinesia."
    Raidt J., Wallmeier J., Hjeij R., Onnebrink J.G., Pennekamp P., Loges N.T., Olbrich H., Haeffner K., Dougherty G.W., Omran H., Werner C.
    Eur. Respir. J. 44:1579-1588(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN CILD22.

Entry informationi

Entry nameiZMY10_HUMAN
AccessioniPrimary (citable) accession number: O75800
Secondary accession number(s): A6NK41
, B3KU54, O14570, O75801, Q53FE6, Q8N4R6, Q8NDN6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: November 8, 2002
Last modified: July 6, 2016
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.