O75800 (ZMY10_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 90.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger MYND domain-containing protein 10 Alternative name(s): Protein BLu | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 440 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Contains 1 MYND-type zinc finger. |
| Sequence caution | The sequence AAB67311.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Zinc-finger |
| Ligand | Metal-binding Zinc |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from direct assay. Source: LIFEdb |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TSC22D4 | Q9Y3Q8 | 2 | EBI-747061,EBI-739485 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75800-1) Also known as: Lung; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75800-2) Also known as: Testis; The sequence of this isoform differs from the canonical sequence as follows: 200-234: SLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGG → RQWSVSQPPQLAHLKRIQRLHPVCWFLSPG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 440 | 440 | Zinc finger MYND domain-containing protein 10 | PRO_0000218314 | |||||||||||||
Regions | |||||||||||||||||
| Zinc finger | 394 – 430 | 37 | MYND-type | ||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 200 – 234 | 35 | SLSLS…RREGG → RQWSVSQPPQLAHLKRIQRL HPVCWFLSPG in isoform 2. | VSP_003328 | |||||||||||||
| Natural variant | 407 | 1 | R → Q in non-small cell lung cancer cell lines. Ref.6 | VAR_014227 | |||||||||||||
Experimental info | |||||||||||||||||
| Sequence conflict | 35 | 1 | Q → R in CAD38688. Ref.2 | ||||||||||||||
| Sequence conflict | 369 | 1 | R → W in AAC24726. Ref.1 | ||||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Beta strand | 395 – 397 | 3 | |||||||||||||||
| Turn | 406 – 408 | 3 | |||||||||||||||
| Helix | 416 – 421 | 6 | |||||||||||||||
| Helix | 423 – 429 | 7 | |||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel gene (BLu) that resides in the lung cancer region on chromosome 3p21.3 has the MYND Zn finger-like module." Duh F.-M., Latif F., Bader S., Sekido Y., Kuzmin I., Minna J.D., Koonin E., Lerman M.I. Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Lung and Testis. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [3] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [6] | "The 630-kb lung cancer homozygous deletion region on human chromosome 3p21.3: identification and evaluation of the resident candidate tumor suppressor genes." The international lung cancer chromosome 3p21.3 tumor suppressor gene consortium Lerman M.I., Minna J.D. Cancer Res. 60:6116-6133(2000) [PubMed: 11085536] [Abstract] Cited for: DISCUSSION OF SEQUENCE, VARIANT GLN-407. |
| [7] | "Solution structure of the MYND domain of the human zinc finger MYND domain-containing protein 10." RIKEN structural genomics initiative (RSGI) Submitted (JUN-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 384-440. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U70824 mRNA. Translation: AAC24726.1. U70880 mRNA. Translation: AAC24728.1. AL833828 mRNA. Translation: CAD38688.1. AC002481 Genomic DNA. Translation: AAB67311.1. Sequence problems. CH471055 Genomic DNA. Translation: EAW65104.1. BC033732 mRNA. Translation: AAH33732.1. | ||||||||||||||||||
| IPI | IPI00220520. IPI00304253. | ||||||||||||||||||
| RefSeq | NP_056980.2. NM_015896.2. | ||||||||||||||||||
| UniGene | Hs.526735. Hs.627171. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | O75800. | ||||||||||||||||||
| SMR | O75800. Positions 384-440. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | O75800. 4 interactions. | ||||||||||||||||||
| MINT | MINT-1476511. | ||||||||||||||||||
| STRING | O75800. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | O75800. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000231749; ENSP00000231749; ENSG00000004838. | ||||||||||||||||||
| GeneID | 51364. | ||||||||||||||||||
| KEGG | hsa:51364. | ||||||||||||||||||
| UCSC | uc003dag.1. human. uc010hll.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 51364. | ||||||||||||||||||
| GeneCards | GC03M050378. | ||||||||||||||||||
| H-InvDB | HIX0200503. | ||||||||||||||||||
| HGNC | HGNC:19412. ZMYND10. | ||||||||||||||||||
| HPA | HPA035255. | ||||||||||||||||||
| MIM | 607070. gene. | ||||||||||||||||||
| neXtProt | NX_O75800. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG18838. | ||||||||||||||||||
| HOGENOM | HBG713239. | ||||||||||||||||||
| HOVERGEN | HBG055814. | ||||||||||||||||||
| InParanoid | O75800. | ||||||||||||||||||
| OMA | WQAIAKH. | ||||||||||||||||||
| OrthoDB | EOG4FXR7P. | ||||||||||||||||||
| PhylomeDB | O75800. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O75800. | ||||||||||||||||||
| Bgee | O75800. | ||||||||||||||||||
| CleanEx | HS_ZMYND10. | ||||||||||||||||||
| Genevestigator | O75800. | ||||||||||||||||||
| GermOnline | ENSG00000004838. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR017333. UCP037948_Znf-MYND. IPR002893. Znf_MYND. [Graphical view] | ||||||||||||||||||
| Pfam | PF01753. zf-MYND. 1 hit. [Graphical view] | ||||||||||||||||||
| PIRSF | PIRSF037948. UCP037948_Znf_MYND10. 1 hit. | ||||||||||||||||||
| PROSITE | PS01360. ZF_MYND_1. 1 hit. PS50865. ZF_MYND_2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 54829. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | ZMY10_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75800 Secondary accession number(s): A6NK41 Q8NDN6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with