Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA repair protein RAD51 homolog 4

Gene

RAD51D

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. Bind to single-stranded DNA (ssDNA) and has DNA-dependent ATPase activity. Part of the Rad21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. Involved in telomere maintenance. The BCDX2 subcomplex XRCC2:RAD51D can stimulate Holliday junction resolution by BLM.7 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi107 – 114ATPSequence analysis8

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • DNA binding Source: ProtInc
  • DNA-dependent ATPase activity Source: UniProtKB
  • double-stranded DNA binding Source: GO_Central
  • gamma-tubulin binding Source: UniProtKB
  • recombinase activity Source: GO_Central
  • single-stranded DNA binding Source: UniProtKB

GO - Biological processi

  • DNA repair Source: ProtInc
  • DNA synthesis involved in DNA repair Source: Reactome
  • double-strand break repair via homologous recombination Source: UniProtKB
  • interstrand cross-link repair Source: Ensembl
  • meiotic DNA recombinase assembly Source: GO_Central
  • mitotic recombination Source: GO_Central
  • nucleotide-excision repair Source: Ensembl
  • reciprocal meiotic recombination Source: ProtInc
  • regulation of cell cycle Source: Ensembl
  • response to ionizing radiation Source: GO_Central
  • strand displacement Source: Reactome
  • strand invasion Source: UniProtKB
  • telomere maintenance Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

DNA damage, DNA recombination, DNA repair

Keywords - Ligandi

ATP-binding, DNA-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000092871-MONOMER.
ReactomeiR-HSA-5685942. HDR through Homologous Recombination (HRR).
R-HSA-5693554. Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA).
R-HSA-5693568. Resolution of D-loop Structures through Holliday Junction Intermediates.
R-HSA-5693579. Homologous DNA Pairing and Strand Exchange.
R-HSA-5693616. Presynaptic phase of homologous DNA pairing and strand exchange.
R-HSA-6796648. TP53 Regulates Transcription of DNA Repair Genes.

Names & Taxonomyi

Protein namesi
Recommended name:
DNA repair protein RAD51 homolog 4
Alternative name(s):
R51H3
RAD51 homolog D
RAD51-like protein 3
TRAD
Gene namesi
Name:RAD51D
Synonyms:RAD51L3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:9823. RAD51D.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
  • chromosome, telomeric region Source: UniProtKB
  • cytoplasm Source: UniProtKB-KW
  • nuclear chromosome, telomeric region Source: BHF-UCL
  • nucleoplasm Source: HPA
  • nucleus Source: ProtInc
  • Rad51B-Rad51C-Rad51D-XRCC2 complex Source: UniProtKB
  • replication fork Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Cytoplasm, Cytoskeleton, Nucleus, Telomere

Pathology & Biotechi

Involvement in diseasei

Breast-ovarian cancer, familial, 4 (BROVCA4)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA condition associated with familial predisposition to cancer of the breast and ovaries. Characteristic features in affected families are an early age of onset of breast cancer (often before age 50), increased chance of bilateral cancers (cancer that develop in both breasts, or both ovaries, independently), frequent occurrence of breast cancer among men, increased incidence of tumors of other specific organs, such as the prostate.
See also OMIM:614291

Organism-specific databases

DisGeNETi5892.
MalaCardsiRAD51D.
MIMi614291. phenotype.
OpenTargetsiENSG00000185379.
Orphaneti145. Hereditary breast and ovarian cancer syndrome.
PharmGKBiPA34179.

Polymorphism and mutation databases

BioMutaiRAD51D.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001229421 – 328DNA repair protein RAD51 homolog 4Add BLAST328

Proteomic databases

MaxQBiO75771.
PaxDbiO75771.
PeptideAtlasiO75771.
PRIDEiO75771.

PTM databases

iPTMnetiO75771.
PhosphoSitePlusiO75771.

Expressioni

Tissue specificityi

Expressed in colon, prostate, spleen, testis, ovary, thymus and small intestine. Weakly expressed in leukocytes.

Gene expression databases

BgeeiENSG00000185379.
ExpressionAtlasiO75771. baseline and differential.
GenevisibleiO75771. HS.

Organism-specific databases

HPAiHPA055550.

Interactioni

Subunit structurei

Part of the BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2; the complex has a ring-like structure arranged into a flat disc around a central channel. In the absence of DNA, the BCDX2 subcomplex XRCC2:RAD51D formed a multimeric ring structure; in the presence of single-stranded DNA it formed a filamentous structure with the ssDNA. Interacts with SWSAP1 and ZSWIM7; involved in homologous recombination repair. Interacts with BLM; required for stimulation of BLM activity by the BCDX2 subcomplex XRCC2:RAD51D.9 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
AMOTL2Q9Y2J43EBI-1055693,EBI-746752
AMOTL2Q9Y2J4-43EBI-1055693,EBI-10187270
BLMP541324EBI-1055693,EBI-621372
C1orf94Q6P1W53EBI-1055693,EBI-946029
CEP57L1Q8IYX8-23EBI-1055693,EBI-10181988
IKZF1Q134224EBI-1055693,EBI-745305
IKZF3Q9UKT95EBI-1055693,EBI-747204
KIFC3Q9BVG83EBI-1055693,EBI-2125614
KRT15P190123EBI-1055693,EBI-739566
LNX1Q8TBB13EBI-1055693,EBI-739832
LZTS2Q9BRK45EBI-1055693,EBI-741037
PRDM14Q9GZV83EBI-1055693,EBI-3957793
RAD51BO153155EBI-1055693,EBI-2824089
RAD51CO435026EBI-1055693,EBI-2267048
SWSAP1Q6NVH72EBI-1055693,EBI-5281637
XRCC2O4354325EBI-1055693,EBI-3918457

GO - Molecular functioni

  • gamma-tubulin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi111829. 36 interactors.
DIPiDIP-24265N.
IntActiO75771. 34 interactors.
MINTiMINT-127795.
STRINGi9606.ENSP00000466834.

Structurei

Secondary structure

1328
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi14 – 22Combined sources9
Helixi28 – 31Combined sources4
Helixi36 – 43Combined sources8
Helixi47 – 61Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KZ3NMR-A1-83[»]
ProteinModelPortaliO75771.
SMRiO75771.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 83preferentially binds ssDNAAdd BLAST83

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi200 – 205Poly-Val6

Sequence similaritiesi

Belongs to the RecA family. RAD51 subfamily.Curated

Phylogenomic databases

eggNOGiKOG1433. Eukaryota.
KOG4275. Eukaryota.
ENOG41101VR. LUCA.
GeneTreeiENSGT00860000133731.
HOGENOMiHOG000049134.
HOVERGENiHBG057455.
InParanoidiO75771.
KOiK10871.
OMAiCSLSYKA.
OrthoDBiEOG091G0SEJ.
PhylomeDBiO75771.

Family and domain databases

CDDicd01123. Rad51_DMC1_radA. 1 hit.
Gene3Di3.40.50.300. 1 hit.
InterProiIPR003593. AAA+_ATPase.
IPR013632. DNA_recomb/repair_Rad51_C.
IPR016467. DNA_recomb/repair_RecA-like.
IPR027417. P-loop_NTPase.
IPR033925. Rad51_DMC1_RadA.
IPR020588. RecA_ATP-bd.
[Graphical view]
PfamiPF08423. Rad51. 1 hit.
[Graphical view]
PIRSFiPIRSF005856. Rad51. 1 hit.
SMARTiSM00382. AAA. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS50162. RECA_2. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75771-1) [UniParc]FASTAAdd to basket
Also known as: TRAD

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGVLRVGLCP GLTEEMIQLL RSHRIKTVVD LVSADLEEVA QKCGLSYKAL
60 70 80 90 100
VALRRVLLAQ FSAFPVNGAD LYEELKTSTA ILSTGIGSLD KLLDAGLYTG
110 120 130 140 150
EVTEIVGGPG SGKTQVCLCM AANVAHGLQQ NVLYVDSNGG LTASRLLQLL
160 170 180 190 200
QAKTQDEEEQ AEALRRIQVV HAFDIFQMLD VLQELRGTVA QQVTGSSGTV
210 220 230 240 250
KVVVVDSVTA VVSPLLGGQQ REGLALMMQL ARELKTLARD LGMAVVVTNH
260 270 280 290 300
ITRDRDSGRL KPALGRSWSF VPSTRILLDT IEGAGASGGR RMACLAKSSR
310 320
QPTGFQEMVD IGTWGTSEQS ATLQGDQT
Length:328
Mass (Da):35,049
Last modified:November 1, 1998 - v1
Checksum:i6038DA9356DF354A
GO
Isoform 2 (identifier: O75771-2) [UniParc]FASTAAdd to basket
Also known as: TRAD-D1, D2

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: A → S
     50-328: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:49
Mass (Da):5,387
Checksum:i0B2D7DC5AF7D3D70
GO
Isoform 3 (identifier: O75771-3) [UniParc]FASTAAdd to basket
Also known as: TRAD-D3

The sequence of this isoform differs from the canonical sequence as follows:
     50-161: Missing.

Show »
Length:216
Mass (Da):23,317
Checksum:i34C5B25933759EC0
GO
Isoform 4 (identifier: O75771-4) [UniParc]FASTAAdd to basket
Also known as: TRAD-D4

The sequence of this isoform differs from the canonical sequence as follows:
     116-160: Missing.

Show »
Length:283
Mass (Da):30,194
Checksum:i77A839A78449DC78
GO
Isoform 5 (identifier: O75771-5) [UniParc]FASTAAdd to basket
Also known as: TRAD-D5

The sequence of this isoform differs from the canonical sequence as follows:
     88-101: SLDKLLDAGLYTGE → RQKLSGGSRWCMHL

Show »
Length:328
Mass (Da):35,214
Checksum:iA494887924CB3834
GO
Isoform 6 (identifier: O75771-6) [UniParc]FASTAAdd to basket
Also known as: TRAD-D6, D7

The sequence of this isoform differs from the canonical sequence as follows:
     88-118: SLDKLLDAGLYTGEVTEIVGGPGSGKTQVCL → RHGGRTQVGTWEDCSCLRSPQGDRGVGSGML
     119-328: Missing.

Show »
Length:118
Mass (Da):12,675
Checksum:iE7A605D379835E0A
GO
Isoform 7 (identifier: O75771-7) [UniParc]FASTAAdd to basket
Also known as: TRAD-D8

The sequence of this isoform differs from the canonical sequence as follows:
     193-212: VTGSSGTVKVVVVDSVTAVV → DGIPEHLNHIPHCLHVHLPC
     213-328: Missing.

Show »
Length:212
Mass (Da):22,975
Checksum:iE2554F3D42E92D58
GO
Isoform 8 (identifier: O75771-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-88: ALVALRRVLL...TAILSTGIGS → TWRAHSSGNL...ERGTAVSTSR

Note: No experimental confirmation available.
Show »
Length:348
Mass (Da):37,014
Checksum:i7371C4C9882D629C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti231A → V in CAB55937 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02056024R → S.1 PublicationCorresponds to variant rs28363257dbSNPEnsembl.1
Natural variantiVAR_020561165R → Q.1 PublicationCorresponds to variant rs4796033dbSNPEnsembl.1
Natural variantiVAR_020562225A → T.1 PublicationCorresponds to variant rs28363282dbSNPEnsembl.1
Natural variantiVAR_020563232R → Q.1 PublicationCorresponds to variant rs28363283dbSNPEnsembl.1
Natural variantiVAR_020564233E → G.1 PublicationCorresponds to variant rs28363284dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04365849 – 88ALVAL…TGIGS → TWRAHSSGNLGGLQLPQVPA GRSWSGVRNALKKAGLGHGG TDGLSLNAFDERGTAVSTSR in isoform 8. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_00555849A → S in isoform 2. Curated1
Alternative sequenceiVSP_00555950 – 328Missing in isoform 2. CuratedAdd BLAST279
Alternative sequenceiVSP_00556050 – 161Missing in isoform 3. CuratedAdd BLAST112
Alternative sequenceiVSP_00556388 – 118SLDKL…TQVCL → RHGGRTQVGTWEDCSCLRSP QGDRGVGSGML in isoform 6. CuratedAdd BLAST31
Alternative sequenceiVSP_00556288 – 101SLDKL…LYTGE → RQKLSGGSRWCMHL in isoform 5. CuratedAdd BLAST14
Alternative sequenceiVSP_005561116 – 160Missing in isoform 4. CuratedAdd BLAST45
Alternative sequenceiVSP_005564119 – 328Missing in isoform 6. CuratedAdd BLAST210
Alternative sequenceiVSP_005565193 – 212VTGSS…VTAVV → DGIPEHLNHIPHCLHVHLPC in isoform 7. CuratedAdd BLAST20
Alternative sequenceiVSP_005566213 – 328Missing in isoform 7. CuratedAdd BLAST116

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y15572 mRNA. Translation: CAA75681.1.
AF034956 mRNA. Translation: AAC39719.1.
AB013341 mRNA. Translation: BAA25914.1.
AB016223 mRNA. Translation: BAA31747.1.
AB016224 mRNA. Translation: BAA31748.1.
AB016225 mRNA. Translation: BAA31749.1.
AB018360 mRNA. Translation: BAA33779.1.
AB018361 mRNA. Translation: BAA33780.1.
AB018362 mRNA. Translation: BAA33781.1.
AB018363 mRNA. Translation: BAA33782.1.
AB020412 mRNA. Translation: BAA34690.1.
AY623116 Genomic DNA. Translation: AAT38112.1.
AK296241 mRNA. Translation: BAG58959.1.
AC022916 Genomic DNA. No translation available.
CH471147 Genomic DNA. Translation: EAW80181.1.
CH471147 Genomic DNA. Translation: EAW80184.1.
CH471147 Genomic DNA. Translation: EAW80196.1.
BC014422 mRNA. Translation: AAH14422.1.
AL117459 mRNA. Translation: CAB55937.1.
CCDSiCCDS11287.1. [O75771-1]
CCDS11288.1. [O75771-3]
CCDS45646.1. [O75771-8]
PIRiT17247.
RefSeqiNP_001136043.1. NM_001142571.1. [O75771-8]
NP_002869.3. NM_002878.3. [O75771-1]
NP_598332.1. NM_133629.2. [O75771-3]
UniGeneiHs.631757.

Genome annotation databases

EnsembliENST00000335858; ENSP00000338408; ENSG00000185379. [O75771-3]
ENST00000345365; ENSP00000338790; ENSG00000185379. [O75771-1]
ENST00000394589; ENSP00000378090; ENSG00000185379. [O75771-1]
ENST00000586044; ENSP00000465584; ENSG00000185379. [O75771-2]
ENST00000587977; ENSP00000466587; ENSG00000185379. [O75771-6]
ENST00000588594; ENSP00000465366; ENSG00000185379. [O75771-2]
ENST00000590016; ENSP00000466399; ENSG00000185379. [O75771-8]
GeneIDi5892.
KEGGihsa:5892.
UCSCiuc002hir.4. human. [O75771-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y15572 mRNA. Translation: CAA75681.1.
AF034956 mRNA. Translation: AAC39719.1.
AB013341 mRNA. Translation: BAA25914.1.
AB016223 mRNA. Translation: BAA31747.1.
AB016224 mRNA. Translation: BAA31748.1.
AB016225 mRNA. Translation: BAA31749.1.
AB018360 mRNA. Translation: BAA33779.1.
AB018361 mRNA. Translation: BAA33780.1.
AB018362 mRNA. Translation: BAA33781.1.
AB018363 mRNA. Translation: BAA33782.1.
AB020412 mRNA. Translation: BAA34690.1.
AY623116 Genomic DNA. Translation: AAT38112.1.
AK296241 mRNA. Translation: BAG58959.1.
AC022916 Genomic DNA. No translation available.
CH471147 Genomic DNA. Translation: EAW80181.1.
CH471147 Genomic DNA. Translation: EAW80184.1.
CH471147 Genomic DNA. Translation: EAW80196.1.
BC014422 mRNA. Translation: AAH14422.1.
AL117459 mRNA. Translation: CAB55937.1.
CCDSiCCDS11287.1. [O75771-1]
CCDS11288.1. [O75771-3]
CCDS45646.1. [O75771-8]
PIRiT17247.
RefSeqiNP_001136043.1. NM_001142571.1. [O75771-8]
NP_002869.3. NM_002878.3. [O75771-1]
NP_598332.1. NM_133629.2. [O75771-3]
UniGeneiHs.631757.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KZ3NMR-A1-83[»]
ProteinModelPortaliO75771.
SMRiO75771.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111829. 36 interactors.
DIPiDIP-24265N.
IntActiO75771. 34 interactors.
MINTiMINT-127795.
STRINGi9606.ENSP00000466834.

PTM databases

iPTMnetiO75771.
PhosphoSitePlusiO75771.

Polymorphism and mutation databases

BioMutaiRAD51D.

Proteomic databases

MaxQBiO75771.
PaxDbiO75771.
PeptideAtlasiO75771.
PRIDEiO75771.

Protocols and materials databases

DNASUi5892.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335858; ENSP00000338408; ENSG00000185379. [O75771-3]
ENST00000345365; ENSP00000338790; ENSG00000185379. [O75771-1]
ENST00000394589; ENSP00000378090; ENSG00000185379. [O75771-1]
ENST00000586044; ENSP00000465584; ENSG00000185379. [O75771-2]
ENST00000587977; ENSP00000466587; ENSG00000185379. [O75771-6]
ENST00000588594; ENSP00000465366; ENSG00000185379. [O75771-2]
ENST00000590016; ENSP00000466399; ENSG00000185379. [O75771-8]
GeneIDi5892.
KEGGihsa:5892.
UCSCiuc002hir.4. human. [O75771-1]

Organism-specific databases

CTDi5892.
DisGeNETi5892.
GeneCardsiRAD51D.
HGNCiHGNC:9823. RAD51D.
HPAiHPA055550.
MalaCardsiRAD51D.
MIMi602954. gene.
614291. phenotype.
neXtProtiNX_O75771.
OpenTargetsiENSG00000185379.
Orphaneti145. Hereditary breast and ovarian cancer syndrome.
PharmGKBiPA34179.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1433. Eukaryota.
KOG4275. Eukaryota.
ENOG41101VR. LUCA.
GeneTreeiENSGT00860000133731.
HOGENOMiHOG000049134.
HOVERGENiHBG057455.
InParanoidiO75771.
KOiK10871.
OMAiCSLSYKA.
OrthoDBiEOG091G0SEJ.
PhylomeDBiO75771.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000092871-MONOMER.
ReactomeiR-HSA-5685942. HDR through Homologous Recombination (HRR).
R-HSA-5693554. Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA).
R-HSA-5693568. Resolution of D-loop Structures through Holliday Junction Intermediates.
R-HSA-5693579. Homologous DNA Pairing and Strand Exchange.
R-HSA-5693616. Presynaptic phase of homologous DNA pairing and strand exchange.
R-HSA-6796648. TP53 Regulates Transcription of DNA Repair Genes.

Miscellaneous databases

GeneWikiiRAD51L3.
GenomeRNAii5892.
PROiO75771.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185379.
ExpressionAtlasiO75771. baseline and differential.
GenevisibleiO75771. HS.

Family and domain databases

CDDicd01123. Rad51_DMC1_radA. 1 hit.
Gene3Di3.40.50.300. 1 hit.
InterProiIPR003593. AAA+_ATPase.
IPR013632. DNA_recomb/repair_Rad51_C.
IPR016467. DNA_recomb/repair_RecA-like.
IPR027417. P-loop_NTPase.
IPR033925. Rad51_DMC1_RadA.
IPR020588. RecA_ATP-bd.
[Graphical view]
PfamiPF08423. Rad51. 1 hit.
[Graphical view]
PIRSFiPIRSF005856. Rad51. 1 hit.
SMARTiSM00382. AAA. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS50162. RECA_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRA51D_HUMAN
AccessioniPrimary (citable) accession number: O75771
Secondary accession number(s): B4DJU7
, E1P637, O43537, O60355, O75196, O75847, O75848, O76073, O76085, O94908, Q9UFU5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: November 30, 2016
This is version 163 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.