O75771 (RA51D_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DNA repair protein RAD51 homolog 4 Alternative name(s): R51H3 RAD51 homolog D RAD51-like protein 3 TRAD | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 328 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. Ref.8 Ref.9 |
| Subunit structure | Part of a BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2. Part of a complex consisting of RAD51B, RAD51C, RAD51D, XRCC2 and XRCC3. Interacts with SWSAP1 and ZSWIM7; involved in homologous recombination repair. Ref.13 |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Expressed in colon, prostate, spleen, testis, ovary, thymus and small intestine. Weakly expressed in leukocytes. |
| Involvement in disease | Defects in RAD51D are a cause of susceptibility to familial breast-ovarian cancer type 4 (BROVCA4) [MIM:614291]. A condition associated with familial predisposition to cancer of the breast and ovaries. Characteristic features in affected families are an early age of onset of breast cancer (often before age 50), increased chance of bilateral cancers (cancer that develop in both breasts, or both ovaries, independently), frequent occurrence of breast cancer among men, increased incidence of tumors of other specific organs, such as the prostate. Ref.15 |
| Sequence similarities | Belongs to the RecA family. RAD51 subfamily. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA damage DNA recombination DNA repair |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding DNA-binding Nucleotide-binding |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | DNA repair Traceable author statement. Source: ProtInc reciprocal meiotic recombinationTraceable author statement. Source: ProtInc |
| Cellular component | nucleus Traceable author statement. Source: ProtInc |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW DNA bindingTraceable author statement. Source: ProtInc DNA-dependent ATPase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75771-1) Also known as: TRAD; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75771-2) Also known as: TRAD-D1; D2; The sequence of this isoform differs from the canonical sequence as follows: 49-49: A → S 50-328: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: O75771-3) Also known as: TRAD-D3; The sequence of this isoform differs from the canonical sequence as follows: 50-161: Missing. | ||||||
| Isoform 4 (identifier: O75771-4) Also known as: TRAD-D4; The sequence of this isoform differs from the canonical sequence as follows: 116-160: Missing. | ||||||
| Isoform 5 (identifier: O75771-5) Also known as: TRAD-D5; The sequence of this isoform differs from the canonical sequence as follows: 88-101: SLDKLLDAGLYTGE → RQKLSGGSRWCMHL | ||||||
| Isoform 6 (identifier: O75771-6) Also known as: TRAD-D6; D7; The sequence of this isoform differs from the canonical sequence as follows: 88-118: SLDKLLDAGLYTGEVTEIVGGPGSGKTQVCL → RHGGRTQVGTWEDCSCLRSPQGDRGVGSGML 119-328: Missing. | ||||||
| Isoform 7 (identifier: O75771-7) Also known as: TRAD-D8; The sequence of this isoform differs from the canonical sequence as follows: 193-212: VTGSSGTVKVVVVDSVTAVV → DGIPEHLNHIPHCLHVHLPC 213-328: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 328 | 328 | DNA repair protein RAD51 homolog 4 | PRO_0000122942 | |||||
Regions | |||||||||
| Nucleotide binding | 107 – 114 | 8 | ATP Potential | ||||||
| Compositional bias | 200 – 205 | 6 | Poly-Val | ||||||
Natural variations | |||||||||
| Alternative sequence | 49 | 1 | A → S in isoform 2. | VSP_005558 | |||||
| Alternative sequence | 50 – 328 | 279 | Missing in isoform 2. | VSP_005559 | |||||
| Alternative sequence | 50 – 161 | 112 | Missing in isoform 3. | VSP_005560 | |||||
| Alternative sequence | 88 – 118 | 31 | SLDKL…TQVCL → RHGGRTQVGTWEDCSCLRSP QGDRGVGSGML in isoform 6. | VSP_005563 | |||||
| Alternative sequence | 88 – 101 | 14 | SLDKL…LYTGE → RQKLSGGSRWCMHL in isoform 5. | VSP_005562 | |||||
| Alternative sequence | 116 – 160 | 45 | Missing in isoform 4. | VSP_005561 | |||||
| Alternative sequence | 119 – 328 | 210 | Missing in isoform 6. | VSP_005564 | |||||
| Alternative sequence | 193 – 212 | 20 | VTGSS…VTAVV → DGIPEHLNHIPHCLHVHLPC in isoform 7. | VSP_005565 | |||||
| Alternative sequence | 213 – 328 | 116 | Missing in isoform 7. | VSP_005566 | |||||
| Natural variant | 24 | 1 | R → S. Ref.4 Corresponds to variant rs28363257 [ dbSNP | Ensembl ]. | VAR_020560 | |||||
| Natural variant | 165 | 1 | R → Q. Ref.4 Corresponds to variant rs4796033 [ dbSNP | Ensembl ]. | VAR_020561 | |||||
| Natural variant | 225 | 1 | A → T. Ref.4 Corresponds to variant rs28363282 [ dbSNP | Ensembl ]. | VAR_020562 | |||||
| Natural variant | 232 | 1 | R → Q. Ref.4 Corresponds to variant rs28363283 [ dbSNP | Ensembl ]. | VAR_020563 | |||||
| Natural variant | 233 | 1 | E → G. Ref.4 Corresponds to variant rs28363284 [ dbSNP | Ensembl ]. | VAR_020564 | |||||
Experimental info | |||||||||
| Sequence conflict | 231 | 1 | A → V in CAB55937. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation of novel human and mouse genes of the recA/RAD51 recombination-repair gene family." Cartwright R., Dunn A.M., Simpson P.J., Tambini C.E., Thacker J. Nucleic Acids Res. 26:1653-1659(1998) [PubMed: 9512535] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Identification, characterization, and genetic mapping of Rad51d, a new mouse and human RAD51/RecA-related gene." Pittman D.L., Weinberg L.R., Schimenti J.C. Genomics 49:103-111(1998) [PubMed: 9570954] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Multiple alternative transcripts of the human homologue of the mouse TRAD/R51H3/RAD51D gene, a member of the recA/RAD51 gene family." Kawabata M., Saeki K. Biochem. Biophys. Res. Commun. 257:156-162(1999) [PubMed: 10092526] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS 2; 3; 4; 5; 6 AND 7). Tissue: Brain. |
| [4] | NIEHS SNPs program Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS SER-24; GLN-165; THR-225; GLN-232 AND GLY-233. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin. |
| [7] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 156-328. Tissue: Uterus. |
| [8] | "Identification and purification of two distinct complexes containing the five RAD51 paralogs." Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. Genes Dev. 15:3296-3307(2001) [PubMed: 11751635] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2. |
| [9] | "Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells." Liu N., Schild D., Thelen M.P., Thompson L.H. Nucleic Acids Res. 30:1009-1015(2002) [PubMed: 11842113] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2. |
| [10] | "RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51." Miller K.A., Yoshikawa D.M., McConnell I.R., Clark R., Schild D., Albala J.S. J. Biol. Chem. 277:8406-8411(2002) [PubMed: 11744692] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D; XRCC2 AND XRCC3. |
| [11] | "Interactions involving the Rad51 paralogs Rad51C and XRCC3 in human cells." Wiese C., Collins D.W., Albala J.S., Thompson L.H., Kronenberg A., Schild D. Nucleic Acids Res. 30:1001-1008(2002) [PubMed: 11842112] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2. |
| [12] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [13] | "Sws1 is a conserved regulator of homologous recombination in eukaryotic cells." Martin V., Chahwan C., Gao H., Blais V., Wohlschlegel J., Yates J.R. III, McGowan C.H., Russell P. EMBO J. 25:2564-2574(2006) [PubMed: 16710300] [Abstract] Cited for: INTERACTION WITH ZSWIM7 AND XRCC2. |
| [14] | "hSWS1.SWSAP1 is an evolutionarily conserved complex required for efficient homologous recombination repair." Liu T., Wan L., Wu Y., Chen J., Huang J. J. Biol. Chem. 286:41758-41766(2011) [PubMed: 21965664] [Abstract] Cited for: INTERACTION WITH SWSAP1 AND ZSWIM7. |
| [15] | "Germline mutations in RAD51D confer susceptibility to ovarian cancer." Loveday C., Turnbull C., Ramsay E., Hughes D., Ruark E., Frankum J.R., Bowden G., Kalmyrzaev B., Warren-Perry M., Snape K., Adlard J.W., Barwell J., Berg J., Brady A.F., Brewer C., Brice G., Chapman C., Cook J. Rahman N.Nat. Genet. 43:879-882(2011) [PubMed: 21822267] [Abstract] Cited for: INVOLVEMENT IN BROVCA4. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y15572 mRNA. Translation: CAA75681.1. AF034956 mRNA. Translation: AAC39719.1. AB013341 mRNA. Translation: BAA25914.1. AB016223 mRNA. Translation: BAA31747.1. AB016224 mRNA. Translation: BAA31748.1. AB016225 mRNA. Translation: BAA31749.1. AB018360 mRNA. Translation: BAA33779.1. AB018361 mRNA. Translation: BAA33780.1. AB018362 mRNA. Translation: BAA33781.1. AB018363 mRNA. Translation: BAA33782.1. AB020412 mRNA. Translation: BAA34690.1. AY623116 Genomic DNA. Translation: AAT38112.1. CH471147 Genomic DNA. Translation: EAW80181.1. CH471147 Genomic DNA. Translation: EAW80196.1. BC014422 mRNA. Translation: AAH14422.1. AL117459 mRNA. Translation: CAB55937.1. |
| IPI | IPI00216381. IPI00216382. IPI00216383. IPI00216384. IPI00216386. IPI00291454. IPI00411326. |
| PIR | T17247. |
| RefSeq | NP_001136043.1. NM_001142571.1. NP_002869.3. NM_002878.3. NP_598332.1. NM_133629.2. |
| UniGene | Hs.631757. |
3D structure databases | |
| ProteinModelPortal | O75771. |
| SMR | O75771. Positions 1-322. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-24265N. |
| MINT | MINT-127795. |
| STRING | O75771. |
PTM databases | |
| PhosphoSite | O75771. |
Proteomic databases | |
| PRIDE | O75771. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000345365; ENSP00000338790; ENSG00000185379. |
| GeneID | 5892. |
| KEGG | hsa:5892. |
| NMPDR | fig|9606.3.peg.13507. |
| UCSC | uc002his.1. human. |
Organism-specific databases | |
| CTD | 5892. |
| GeneCards | GC17M033427. |
| H-InvDB | HIX0013721. |
| HGNC | HGNC:9823. RAD51D. |
| MIM | 602954. gene. 614291. phenotype. |
| neXtProt | NX_O75771. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10734. |
| HOVERGEN | HBG057455. |
| OMA | AHSLQQN. |
| OrthoDB | EOG4K0QP3. |
| PhylomeDB | O75771. |
Gene expression databases | |
| ArrayExpress | O75771. |
| Bgee | O75771. |
| Genevestigator | O75771. |
| GermOnline | ENSG00000185379. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003593. ATPase_AAA+_core. IPR013632. DNA_recomb/repair_Rad51_C. IPR016467. DNA_recomb/repair_RecA-like. IPR020588. DNA_recomb_RecA/RadB_ATP-bd. [Graphical view] |
| KO | K10871. |
| Pfam | PF08423. Rad51. 1 hit. [Graphical view] |
| PIRSF | PIRSF005856. Rad51. 1 hit. |
| SMART | SM00382. AAA. 1 hit. [Graphical view] |
| PROSITE | PS50162. RECA_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 22920. |
| SOURCE | Search... |
Entry information
| Entry name | RA51D_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75771 Secondary accession number(s): E1P637 Q9UFU5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with