Reviewed,
UniProtKB/Swiss-Prot O75771 (RA51D_HUMAN)
Last modified
November 24, 2009.
Version 97.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: DNA repair protein RAD51 homolog 4 Alternative name(s): R51H3 RAD51-like protein 3 TRAD | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 328 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. Ref.7 Ref.8 |
| Subunit structure | Part of a BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2. Part of a complex consisting of RAD51B, RAD51C, RAD51D, XRCC2 and XRCC3. Interacts with ZSWIM7. Ref.12 |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Expressed in colon, prostate, spleen, testis, ovary, thymus and small intestine. Weakly expressed in leukocytes. |
| Sequence similarities | Belongs to the recA family. RAD51 subfamily. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA damage DNA recombination DNA repair |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding DNA-binding Nucleotide-binding |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | base-excision repair Inferred from electronic annotation. Source: InterPro reciprocal meiotic recombination Ref.2Traceable author statement. Source: ProtInc |
| Cellular component | nucleus Ref.2 Traceable author statement. Source: ProtInc |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW DNA binding Ref.2Traceable author statement. Source: ProtInc DNA-dependent ATPase activityInferred from electronic annotation. Source: InterPro protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DCD | P81605 | 1 | EBI-1055693,EBI-395625 | |
| RADIL | Q96JH8 | 1 | EBI-1055693,EBI-744267 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75771-1) Also known as: TRAD; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75771-2) Also known as: TRAD-D1; D2; The sequence of this isoform differs from the canonical sequence as follows: 49-49: A → S 50-328: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: O75771-3) Also known as: TRAD-D3; The sequence of this isoform differs from the canonical sequence as follows: 50-161: Missing. | ||||||
| Isoform 4 (identifier: O75771-4) Also known as: TRAD-D4; The sequence of this isoform differs from the canonical sequence as follows: 116-160: Missing. | ||||||
| Isoform 5 (identifier: O75771-5) Also known as: TRAD-D5; The sequence of this isoform differs from the canonical sequence as follows: 88-101: SLDKLLDAGLYTGE → RQKLSGGSRWCMHL | ||||||
| Isoform 6 (identifier: O75771-6) Also known as: TRAD-D6; D7; The sequence of this isoform differs from the canonical sequence as follows: 88-118: SLDKLLDAGLYTGEVTEIVGGPGSGKTQVCL → RHGGRTQVGTWEDCSCLRSPQGDRGVGSGML 119-328: Missing. | ||||||
| Isoform 7 (identifier: O75771-7) Also known as: TRAD-D8; The sequence of this isoform differs from the canonical sequence as follows: 193-212: VTGSSGTVKVVVVDSVTAVV → DGIPEHLNHIPHCLHVHLPC 213-328: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 328 | 328 | DNA repair protein RAD51 homolog 4 | PRO_0000122942 | |||||
Regions | |||||||||
| Nucleotide binding | 107 – 114 | 8 | ATP Potential | ||||||
| Compositional bias | 200 – 205 | 6 | Poly-Val | ||||||
Natural variations | |||||||||
| Alternative sequence | 49 | 1 | A → S in isoform 2. | VSP_005558 | |||||
| Alternative sequence | 50 – 328 | 279 | Missing in isoform 2. | VSP_005559 | |||||
| Alternative sequence | 50 – 161 | 112 | Missing in isoform 3. | VSP_005560 | |||||
| Alternative sequence | 88 – 118 | 31 | SLDKL…TQVCL → RHGGRTQVGTWEDCSCLRSP QGDRGVGSGML in isoform 6. | VSP_005563 | |||||
| Alternative sequence | 88 – 101 | 14 | SLDKL…LYTGE → RQKLSGGSRWCMHL in isoform 5. | VSP_005562 | |||||
| Alternative sequence | 116 – 160 | 45 | Missing in isoform 4. | VSP_005561 | |||||
| Alternative sequence | 119 – 328 | 210 | Missing in isoform 6. | VSP_005564 | |||||
| Alternative sequence | 193 – 212 | 20 | VTGSS…VTAVV → DGIPEHLNHIPHCLHVHLPC in isoform 7. | VSP_005565 | |||||
| Alternative sequence | 213 – 328 | 116 | Missing in isoform 7. | VSP_005566 | |||||
| Natural variant | 24 | 1 | R → S: dbSNP rs28363257. | VAR_020560 | |||||
| Natural variant | 165 | 1 | R → Q: dbSNP rs4796033. Ref.4 | VAR_020561 | |||||
| Natural variant | 225 | 1 | A → T: dbSNP rs28363282. Ref.4 | VAR_020562 | |||||
| Natural variant | 232 | 1 | R → Q: dbSNP rs28363283. | VAR_020563 | |||||
| Natural variant | 233 | 1 | E → G: dbSNP rs28363284. Ref.4 | VAR_020564 | |||||
Experimental info | |||||||||
| Sequence conflict | 231 | 1 | A → V in CAB55937. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation of novel human and mouse genes of the recA/RAD51 recombination-repair gene family." Cartwright R., Dunn A.M., Simpson P.J., Tambini C.E., Thacker J. Nucleic Acids Res. 26:1653-1659(1998) [PubMed: 9512535] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Identification, characterization, and genetic mapping of Rad51d, a new mouse and human RAD51/RecA-related gene." Pittman D.L., Weinberg L.R., Schimenti J.C. Genomics 49:103-111(1998) [PubMed: 9570954] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Multiple alternative transcripts of the human homologue of the mouse TRAD/R51H3/RAD51D gene, a member of the recA/RAD51 gene family." Kawabata M., Saeki K. Biochem. Biophys. Res. Commun. 257:156-162(1999) [PubMed: 10092526] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS 2; 3; 4; 5; 6 AND 7). Tissue: Brain. |
| [4] | NIEHS SNPs program Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS SER-24; GLN-165; THR-225; GLN-232 AND GLY-233. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 156-328. Tissue: Uterus. |
| [7] | "Identification and purification of two distinct complexes containing the five RAD51 paralogs." Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. Genes Dev. 15:3296-3307(2001) [PubMed: 11751635] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2. |
| [8] | "Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells." Liu N., Schild D., Thelen M.P., Thompson L.H. Nucleic Acids Res. 30:1009-1015(2002) [PubMed: 11842113] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2. |
| [9] | "RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51." Miller K.A., Yoshikawa D.M., McConnell I.R., Clark R., Schild D., Albala J.S. J. Biol. Chem. 277:8406-8411(2002) [PubMed: 11744692] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D; XRCC2 AND XRCC3. |
| [10] | "Interactions involving the Rad51 paralogs Rad51C and XRCC3 in human cells." Wiese C., Collins D.W., Albala J.S., Thompson L.H., Kronenberg A., Schild D. Nucleic Acids Res. 30:1001-1008(2002) [PubMed: 11842112] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2. |
| [11] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [12] | "Sws1 is a conserved regulator of homologous recombination in eukaryotic cells." Martin V., Chahwan C., Gao H., Blais V., Wohlschlegel J., Yates J.R. III, McGowan C.H., Russell P. EMBO J. 25:2564-2574(2006) [PubMed: 16710300] [Abstract] Cited for: INTERACTION WITH ZSWIM7 AND XRCC2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| Y15572 mRNA. Translation: CAA75681.1. AF034956 mRNA. Translation: AAC39719.1. AB013341 mRNA. Translation: BAA25914.1. AB016223 mRNA. Translation: BAA31747.1. AB016224 mRNA. Translation: BAA31748.1. AB016225 mRNA. Translation: BAA31749.1. AB018360 mRNA. Translation: BAA33779.1. AB018361 mRNA. Translation: BAA33780.1. AB018362 mRNA. Translation: BAA33781.1. AB018363 mRNA. Translation: BAA33782.1. AB020412 mRNA. Translation: BAA34690.1. AY623116 Genomic DNA. Translation: AAT38112.1. BC014422 mRNA. Translation: AAH14422.1. AL117459 mRNA. Translation: CAB55937.1. | |
| IPI | IPI00216381. IPI00216382. IPI00216383. IPI00216384. IPI00216386. IPI00291454. IPI00411326. |
| PIR | T17247. |
| RefSeq | NP_001136043.1. NP_002869.3. NP_598332.1. |
| UniGene | Hs.631757 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP:24265N. |
| IntAct | O75771. 2 interactions. |
| STRING | O75771. |
PTM databases | |
| PhosphoSite | O75771. |
Proteomic databases | |
| PRIDE | O75771. |
Genome annotation databases | |
| Ensembl | ENST00000345365; ENSP00000338790; ENSG00000185379; Homo sapiens. [Genome view] |
| GeneID | 5892. |
| KEGG | hsa:5892. |
| NMPDR | fig|9606.3.peg.13507. |
| UCSC | uc002his.1. human. |
Organism-specific databases | |
| CTD | 5892. |
| GeneCards | GC17M030450. |
| H-InvDB | HIX0013721. |
| HGNC | HGNC:9823. RAD51L3. |
| MIM | 602954. gene. |
| PharmGKB | PA34179. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | O75771. |
| OMA | QVCLCVA |
Gene expression databases | |
| ArrayExpress | O75771. |
| Bgee | O75771. |
| Genevestigator | O75771. |
| GermOnline | ENSG00000185379. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003593. ATPase_AAA+_core. IPR016467. DNA_recomb/repair_RecA-like. IPR020588. DNA_recomb_RecA/RadB_ATP-bd. IPR003265. HhH-GPD_domain. [Graphical view] |
| Pfam | PF00730. HhH-GPD. 1 hit. [Graphical view] |
| PIRSF | PIRSF005856. Rad51. 1 hit. |
| SMART | SM00382. AAA. 1 hit. [Graphical view] |
| PROSITE | PS50162. RECA_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 22920. |
| SOURCE | Search... |
Entry information
| Entry name | RA51D_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75771 Secondary accession number(s): O43537 Q9UFU5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


