SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75771

- RA51D_HUMAN

UniProt

O75771 - RA51D_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

DNA repair protein RAD51 homolog 4

Gene
RAD51D, RAD51L3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. Bind to single-stranded DNA (ssDNA) and has DNA-dependent ATPase activity. Part of the Rad21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. Involved in telomere maintenance. The BCDX2 subcomplex XRCC2:RAD51D can stimulate Holliday junction resolution by BLM.7 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi107 – 1148ATP Reviewed prediction

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. DNA binding Source: ProtInc
  3. DNA-dependent ATPase activity Source: UniProtKB
  4. gamma-tubulin binding Source: UniProtKB
  5. protein binding Source: IntAct
  6. single-stranded DNA binding Source: UniProtKB

GO - Biological processi

  1. ATP catabolic process Source: GOC
  2. DNA repair Source: ProtInc
  3. double-strand break repair via homologous recombination Source: UniProtKB
  4. reciprocal meiotic recombination Source: ProtInc
  5. strand invasion Source: UniProtKB
  6. telomere maintenance Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

DNA damage, DNA recombination, DNA repair

Keywords - Ligandi

ATP-binding, DNA-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
DNA repair protein RAD51 homolog 4
Alternative name(s):
R51H3
RAD51 homolog D
RAD51-like protein 3
TRAD
Gene namesi
Name:RAD51D
Synonyms:RAD51L3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:9823. RAD51D.

Subcellular locationi

Nucleus Inferred. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Chromosometelomere 2 Publications

GO - Cellular componenti

  1. centrosome Source: UniProtKB
  2. chromosome, telomeric region Source: UniProtKB
  3. cytoplasm Source: UniProtKB-KW
  4. nucleus Source: ProtInc
  5. Rad51B-Rad51C-Rad51D-XRCC2 complex Source: UniProtKB
  6. replication fork Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Cytoplasm, Cytoskeleton, Nucleus, Telomere

Pathology & Biotechi

Involvement in diseasei

Breast-ovarian cancer, familial, 4 (BROVCA4) [MIM:614291]: A condition associated with familial predisposition to cancer of the breast and ovaries. Characteristic features in affected families are an early age of onset of breast cancer (often before age 50), increased chance of bilateral cancers (cancer that develop in both breasts, or both ovaries, independently), frequent occurrence of breast cancer among men, increased incidence of tumors of other specific organs, such as the prostate.
Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.1 Publication

Organism-specific databases

MIMi614291. phenotype.
Orphaneti145. Hereditary breast and ovarian cancer syndrome.
PharmGKBiPA34179.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 328328DNA repair protein RAD51 homolog 4PRO_0000122942Add
BLAST

Proteomic databases

MaxQBiO75771.
PaxDbiO75771.
PRIDEiO75771.

PTM databases

PhosphoSiteiO75771.

Expressioni

Tissue specificityi

Expressed in colon, prostate, spleen, testis, ovary, thymus and small intestine. Weakly expressed in leukocytes.

Gene expression databases

ArrayExpressiO75771.
BgeeiO75771.
GenevestigatoriO75771.

Interactioni

Subunit structurei

Part of the BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2; the complex has a ring-like structure arranged into a flat disc around a central channel. In the absence of DNA, the BCDX2 subcomplex XRCC2:RAD51D formed a multimeric ring structure; in the presence of single-stranded DNA it formed a filamentous structure with the ssDNA. Interacts with SWSAP1 and ZSWIM7; involved in homologous recombination repair. Interacts with BLM; required for stimulation of BLM activity by the BCDX2 subcomplex XRCC2:RAD51D.9 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BLMP541324EBI-1055693,EBI-621372
RAD51BO153155EBI-1055693,EBI-2824089
RAD51CO435026EBI-1055693,EBI-2267048
SWSAP1Q6NVH72EBI-1055693,EBI-5281637
XRCC2O4354316EBI-1055693,EBI-3918457

Protein-protein interaction databases

BioGridi111829. 10 interactions.
DIPiDIP-24265N.
IntActiO75771. 10 interactions.
MINTiMINT-127795.

Structurei

Secondary structure

1
328
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi14 – 229
Helixi28 – 314
Helixi36 – 438
Helixi47 – 6115

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2KZ3NMR-A1-83[»]
ProteinModelPortaliO75771.
SMRiO75771. Positions 1-304.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 8383Preferencially binds ssDNAAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi200 – 2056Poly-Val

Sequence similaritiesi

Belongs to the RecA family. RAD51 subfamily.

Phylogenomic databases

eggNOGiCOG0468.
HOGENOMiHOG000049134.
HOVERGENiHBG057455.
KOiK10871.
OMAiCSLSYKA.
PhylomeDBiO75771.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR003593. AAA+_ATPase.
IPR013632. DNA_recomb/repair_Rad51_C.
IPR016467. DNA_recomb/repair_RecA-like.
IPR027417. P-loop_NTPase.
IPR020588. RecA_ATP-bd.
[Graphical view]
PfamiPF08423. Rad51. 1 hit.
[Graphical view]
PIRSFiPIRSF005856. Rad51. 1 hit.
SMARTiSM00382. AAA. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS50162. RECA_2. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O75771-1) [UniParc]FASTAAdd to Basket

Also known as: TRAD

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGVLRVGLCP GLTEEMIQLL RSHRIKTVVD LVSADLEEVA QKCGLSYKAL    50
VALRRVLLAQ FSAFPVNGAD LYEELKTSTA ILSTGIGSLD KLLDAGLYTG 100
EVTEIVGGPG SGKTQVCLCM AANVAHGLQQ NVLYVDSNGG LTASRLLQLL 150
QAKTQDEEEQ AEALRRIQVV HAFDIFQMLD VLQELRGTVA QQVTGSSGTV 200
KVVVVDSVTA VVSPLLGGQQ REGLALMMQL ARELKTLARD LGMAVVVTNH 250
ITRDRDSGRL KPALGRSWSF VPSTRILLDT IEGAGASGGR RMACLAKSSR 300
QPTGFQEMVD IGTWGTSEQS ATLQGDQT 328
Length:328
Mass (Da):35,049
Last modified:November 1, 1998 - v1
Checksum:i6038DA9356DF354A
GO
Isoform 2 (identifier: O75771-2) [UniParc]FASTAAdd to Basket

Also known as: TRAD-D1, D2

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: A → S
     50-328: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:49
Mass (Da):5,387
Checksum:i0B2D7DC5AF7D3D70
GO
Isoform 3 (identifier: O75771-3) [UniParc]FASTAAdd to Basket

Also known as: TRAD-D3

The sequence of this isoform differs from the canonical sequence as follows:
     50-161: Missing.

Show »
Length:216
Mass (Da):23,317
Checksum:i34C5B25933759EC0
GO
Isoform 4 (identifier: O75771-4) [UniParc]FASTAAdd to Basket

Also known as: TRAD-D4

The sequence of this isoform differs from the canonical sequence as follows:
     116-160: Missing.

Show »
Length:283
Mass (Da):30,194
Checksum:i77A839A78449DC78
GO
Isoform 5 (identifier: O75771-5) [UniParc]FASTAAdd to Basket

Also known as: TRAD-D5

The sequence of this isoform differs from the canonical sequence as follows:
     88-101: SLDKLLDAGLYTGE → RQKLSGGSRWCMHL

Show »
Length:328
Mass (Da):35,214
Checksum:iA494887924CB3834
GO
Isoform 6 (identifier: O75771-6) [UniParc]FASTAAdd to Basket

Also known as: TRAD-D6, D7

The sequence of this isoform differs from the canonical sequence as follows:
     88-118: SLDKLLDAGLYTGEVTEIVGGPGSGKTQVCL → RHGGRTQVGTWEDCSCLRSPQGDRGVGSGML
     119-328: Missing.

Show »
Length:118
Mass (Da):12,675
Checksum:iE7A605D379835E0A
GO
Isoform 7 (identifier: O75771-7) [UniParc]FASTAAdd to Basket

Also known as: TRAD-D8

The sequence of this isoform differs from the canonical sequence as follows:
     193-212: VTGSSGTVKVVVVDSVTAVV → DGIPEHLNHIPHCLHVHLPC
     213-328: Missing.

Show »
Length:212
Mass (Da):22,975
Checksum:iE2554F3D42E92D58
GO
Isoform 8 (identifier: O75771-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-88: ALVALRRVLL...TAILSTGIGS → TWRAHSSGNL...ERGTAVSTSR

Note: No experimental confirmation available.

Show »
Length:348
Mass (Da):37,014
Checksum:i7371C4C9882D629C
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti24 – 241R → S.1 Publication
Corresponds to variant rs28363257 [ dbSNP | Ensembl ].
VAR_020560
Natural varianti165 – 1651R → Q.1 Publication
Corresponds to variant rs4796033 [ dbSNP | Ensembl ].
VAR_020561
Natural varianti225 – 2251A → T.1 Publication
Corresponds to variant rs28363282 [ dbSNP | Ensembl ].
VAR_020562
Natural varianti232 – 2321R → Q.1 Publication
Corresponds to variant rs28363283 [ dbSNP | Ensembl ].
VAR_020563
Natural varianti233 – 2331E → G.1 Publication
Corresponds to variant rs28363284 [ dbSNP | Ensembl ].
VAR_020564

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei49 – 8840ALVAL…TGIGS → TWRAHSSGNLGGLQLPQVPA GRSWSGVRNALKKAGLGHGG TDGLSLNAFDERGTAVSTSR in isoform 8. VSP_043658Add
BLAST
Alternative sequencei49 – 491A → S in isoform 2. VSP_005558
Alternative sequencei50 – 328279Missing in isoform 2. VSP_005559Add
BLAST
Alternative sequencei50 – 161112Missing in isoform 3. VSP_005560Add
BLAST
Alternative sequencei88 – 11831SLDKL…TQVCL → RHGGRTQVGTWEDCSCLRSP QGDRGVGSGML in isoform 6. VSP_005563Add
BLAST
Alternative sequencei88 – 10114SLDKL…LYTGE → RQKLSGGSRWCMHL in isoform 5. VSP_005562Add
BLAST
Alternative sequencei116 – 16045Missing in isoform 4. VSP_005561Add
BLAST
Alternative sequencei119 – 328210Missing in isoform 6. VSP_005564Add
BLAST
Alternative sequencei193 – 21220VTGSS…VTAVV → DGIPEHLNHIPHCLHVHLPC in isoform 7. VSP_005565Add
BLAST
Alternative sequencei213 – 328116Missing in isoform 7. VSP_005566Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti231 – 2311A → V in CAB55937. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y15572 mRNA. Translation: CAA75681.1.
AF034956 mRNA. Translation: AAC39719.1.
AB013341 mRNA. Translation: BAA25914.1.
AB016223 mRNA. Translation: BAA31747.1.
AB016224 mRNA. Translation: BAA31748.1.
AB016225 mRNA. Translation: BAA31749.1.
AB018360 mRNA. Translation: BAA33779.1.
AB018361 mRNA. Translation: BAA33780.1.
AB018362 mRNA. Translation: BAA33781.1.
AB018363 mRNA. Translation: BAA33782.1.
AB020412 mRNA. Translation: BAA34690.1.
AY623116 Genomic DNA. Translation: AAT38112.1.
AK296241 mRNA. Translation: BAG58959.1.
AC022916 Genomic DNA. No translation available.
CH471147 Genomic DNA. Translation: EAW80181.1.
CH471147 Genomic DNA. Translation: EAW80184.1.
CH471147 Genomic DNA. Translation: EAW80196.1.
BC014422 mRNA. Translation: AAH14422.1.
AL117459 mRNA. Translation: CAB55937.1.
CCDSiCCDS11287.1. [O75771-1]
CCDS11288.1. [O75771-3]
CCDS45646.1. [O75771-8]
PIRiT17247.
RefSeqiNP_001136043.1. NM_001142571.1. [O75771-8]
NP_002869.3. NM_002878.3. [O75771-1]
NP_598332.1. NM_133629.2. [O75771-3]
UniGeneiHs.631757.

Genome annotation databases

EnsembliENST00000335858; ENSP00000338408; ENSG00000185379. [O75771-3]
ENST00000345365; ENSP00000338790; ENSG00000185379. [O75771-1]
ENST00000357906; ENSP00000350581; ENSG00000185379. [O75771-6]
ENST00000360276; ENSP00000353417; ENSG00000185379. [O75771-4]
ENST00000394589; ENSP00000378090; ENSG00000185379. [O75771-1]
ENST00000586044; ENSP00000465584; ENSG00000185379. [O75771-2]
ENST00000587977; ENSP00000466587; ENSG00000185379. [O75771-6]
ENST00000588594; ENSP00000465366; ENSG00000185379. [O75771-2]
ENST00000590016; ENSP00000466399; ENSG00000185379. [O75771-8]
GeneIDi5892.
KEGGihsa:5892.
UCSCiuc002hir.2. human. [O75771-1]
uc002his.2. human. [O75771-3]
uc010wcd.1. human. [O75771-8]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y15572 mRNA. Translation: CAA75681.1 .
AF034956 mRNA. Translation: AAC39719.1 .
AB013341 mRNA. Translation: BAA25914.1 .
AB016223 mRNA. Translation: BAA31747.1 .
AB016224 mRNA. Translation: BAA31748.1 .
AB016225 mRNA. Translation: BAA31749.1 .
AB018360 mRNA. Translation: BAA33779.1 .
AB018361 mRNA. Translation: BAA33780.1 .
AB018362 mRNA. Translation: BAA33781.1 .
AB018363 mRNA. Translation: BAA33782.1 .
AB020412 mRNA. Translation: BAA34690.1 .
AY623116 Genomic DNA. Translation: AAT38112.1 .
AK296241 mRNA. Translation: BAG58959.1 .
AC022916 Genomic DNA. No translation available.
CH471147 Genomic DNA. Translation: EAW80181.1 .
CH471147 Genomic DNA. Translation: EAW80184.1 .
CH471147 Genomic DNA. Translation: EAW80196.1 .
BC014422 mRNA. Translation: AAH14422.1 .
AL117459 mRNA. Translation: CAB55937.1 .
CCDSi CCDS11287.1. [O75771-1 ]
CCDS11288.1. [O75771-3 ]
CCDS45646.1. [O75771-8 ]
PIRi T17247.
RefSeqi NP_001136043.1. NM_001142571.1. [O75771-8 ]
NP_002869.3. NM_002878.3. [O75771-1 ]
NP_598332.1. NM_133629.2. [O75771-3 ]
UniGenei Hs.631757.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2KZ3 NMR - A 1-83 [» ]
ProteinModelPortali O75771.
SMRi O75771. Positions 1-304.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111829. 10 interactions.
DIPi DIP-24265N.
IntActi O75771. 10 interactions.
MINTi MINT-127795.

PTM databases

PhosphoSitei O75771.

Proteomic databases

MaxQBi O75771.
PaxDbi O75771.
PRIDEi O75771.

Protocols and materials databases

DNASUi 5892.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000335858 ; ENSP00000338408 ; ENSG00000185379 . [O75771-3 ]
ENST00000345365 ; ENSP00000338790 ; ENSG00000185379 . [O75771-1 ]
ENST00000357906 ; ENSP00000350581 ; ENSG00000185379 . [O75771-6 ]
ENST00000360276 ; ENSP00000353417 ; ENSG00000185379 . [O75771-4 ]
ENST00000394589 ; ENSP00000378090 ; ENSG00000185379 . [O75771-1 ]
ENST00000586044 ; ENSP00000465584 ; ENSG00000185379 . [O75771-2 ]
ENST00000587977 ; ENSP00000466587 ; ENSG00000185379 . [O75771-6 ]
ENST00000588594 ; ENSP00000465366 ; ENSG00000185379 . [O75771-2 ]
ENST00000590016 ; ENSP00000466399 ; ENSG00000185379 . [O75771-8 ]
GeneIDi 5892.
KEGGi hsa:5892.
UCSCi uc002hir.2. human. [O75771-1 ]
uc002his.2. human. [O75771-3 ]
uc010wcd.1. human. [O75771-8 ]

Organism-specific databases

CTDi 5892.
GeneCardsi GC17M033427.
HGNCi HGNC:9823. RAD51D.
MIMi 602954. gene.
614291. phenotype.
neXtProti NX_O75771.
Orphaneti 145. Hereditary breast and ovarian cancer syndrome.
PharmGKBi PA34179.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0468.
HOGENOMi HOG000049134.
HOVERGENi HBG057455.
KOi K10871.
OMAi CSLSYKA.
PhylomeDBi O75771.

Miscellaneous databases

GeneWikii RAD51L3.
GenomeRNAii 5892.
NextBioi 22920.
PROi O75771.
SOURCEi Search...

Gene expression databases

ArrayExpressi O75771.
Bgeei O75771.
Genevestigatori O75771.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR003593. AAA+_ATPase.
IPR013632. DNA_recomb/repair_Rad51_C.
IPR016467. DNA_recomb/repair_RecA-like.
IPR027417. P-loop_NTPase.
IPR020588. RecA_ATP-bd.
[Graphical view ]
Pfami PF08423. Rad51. 1 hit.
[Graphical view ]
PIRSFi PIRSF005856. Rad51. 1 hit.
SMARTi SM00382. AAA. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
PROSITEi PS50162. RECA_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation of novel human and mouse genes of the recA/RAD51 recombination-repair gene family."
    Cartwright R., Dunn A.M., Simpson P.J., Tambini C.E., Thacker J.
    Nucleic Acids Res. 26:1653-1659(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Identification, characterization, and genetic mapping of Rad51d, a new mouse and human RAD51/RecA-related gene."
    Pittman D.L., Weinberg L.R., Schimenti J.C.
    Genomics 49:103-111(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Multiple alternative transcripts of the human homologue of the mouse TRAD/R51H3/RAD51D gene, a member of the recA/RAD51 gene family."
    Kawabata M., Saeki K.
    Biochem. Biophys. Res. Commun. 257:156-162(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING (ISOFORMS 2; 3; 4; 5; 6 AND 7).
    Tissue: Brain.
  4. NIEHS SNPs program
    Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS SER-24; GLN-165; THR-225; GLN-232 AND GLY-233.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8).
    Tissue: Thalamus.
  6. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Skin.
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 156-328.
    Tissue: Uterus.
  10. "The RAD51 family member, RAD51L3, is a DNA-stimulated ATPase that forms a complex with XRCC2."
    Braybrooke J.P., Spink K.G., Thacker J., Hickson I.D.
    J. Biol. Chem. 275:29100-29106(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH XRCC2.
  11. "Identification and purification of two distinct complexes containing the five RAD51 paralogs."
    Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C.
    Genes Dev. 15:3296-3307(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2.
  12. "Homologous pairing and ring and filament structure formation activities of the human Xrcc2*Rad51D complex."
    Kurumizaka H., Ikawa S., Nakada M., Enomoto R., Kagawa W., Kinebuchi T., Yamazoe M., Yokoyama S., Shibata T.
    J. Biol. Chem. 277:14315-14320(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBUNIT.
  13. "Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells."
    Liu N., Schild D., Thelen M.P., Thompson L.H.
    Nucleic Acids Res. 30:1009-1015(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2.
  14. "RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51."
    Miller K.A., Yoshikawa D.M., McConnell I.R., Clark R., Schild D., Albala J.S.
    J. Biol. Chem. 277:8406-8411(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBUNIT.
  15. "Interactions involving the Rad51 paralogs Rad51C and XRCC3 in human cells."
    Wiese C., Collins D.W., Albala J.S., Thompson L.H., Kronenberg A., Schild D.
    Nucleic Acids Res. 30:1001-1008(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2.
  16. "Functional interaction between the Bloom's syndrome helicase and the RAD51 paralog, RAD51L3 (RAD51D)."
    Braybrooke J.P., Li J.L., Wu L., Caple F., Benson F.E., Hickson I.D.
    J. Biol. Chem. 278:48357-48366(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION OF THE BCDX2 COMPLEX, INTERACTION WITH BLM AND XRCC2.
  17. "Telomere maintenance requires the RAD51D recombination/repair protein."
    Tarsounas M., Munoz P., Claas A., Smiraldo P.G., Pittman D.L., Blasco M.A., West S.C.
    Cell 117:337-347(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  18. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
  19. "Sws1 is a conserved regulator of homologous recombination in eukaryotic cells."
    Martin V., Chahwan C., Gao H., Blais V., Wohlschlegel J., Yates J.R. III, McGowan C.H., Russell P.
    EMBO J. 25:2564-2574(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ZSWIM7 AND XRCC2.
  20. "Homologous recombination proteins are associated with centrosomes and are required for mitotic stability."
    Cappelli E., Townsend S., Griffin C., Thacker J.
    Exp. Cell Res. 317:1203-1213(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  21. "hSWS1.SWSAP1 is an evolutionarily conserved complex required for efficient homologous recombination repair."
    Liu T., Wan L., Wu Y., Chen J., Huang J.
    J. Biol. Chem. 286:41758-41766(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SWSAP1 AND ZSWIM7.
  22. Cited for: INVOLVEMENT IN BROVCA4.
  23. "Rad51 paralog complexes BCDX2 and CX3 act at different stages in the BRCA1-BRCA2-dependent homologous recombination pathway."
    Chun J., Buechelmaier E.S., Powell S.N.
    Mol. Cell. Biol. 33:387-395(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION OF THE BCDX2 COMPLEX.
  24. "Structural and functional characterization of the N-terminal domain of human Rad51D."
    Kim Y.M., Choi B.S.
    Int. J. Biochem. Cell Biol. 43:416-422(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 1-83, DNA-BINDING.

Entry informationi

Entry nameiRA51D_HUMAN
AccessioniPrimary (citable) accession number: O75771
Secondary accession number(s): B4DJU7
, E1P637, O43537, O60355, O75196, O75847, O75848, O76073, O76085, O94908, Q9UFU5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: July 9, 2014
This is version 139 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi