Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Arf-GAP with dual PH domain-containing protein 1

Gene

ADAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GTPase-activating protein for the ADP ribosylation factor family (Probable). Binds phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate (InsP4).1 PublicationCurated1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri21 – 44C4-typePROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

  • GTPase activator activity Source: UniProtKB
  • inositol 1,3,4,5 tetrakisphosphate binding Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • phosphatidylinositol-3,4,5-trisphosphate binding Source: Ensembl

GO - Biological processi

  • cell surface receptor signaling pathway Source: ProtInc
  • regulation of GTPase activity Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000105963-MONOMER.
SIGNORiO75689.

Names & Taxonomyi

Protein namesi
Recommended name:
Arf-GAP with dual PH domain-containing protein 1
Alternative name(s):
Centaurin-alpha-1
Short name:
Cnt-a1
Putative MAPK-activating protein PM25
Gene namesi
Name:ADAP1
Synonyms:CENTA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:16486. ADAP1.

Subcellular locationi

  • Nucleus
  • Cytoplasm

  • Note: Recruited to the plasma membrane upon epidermal growth factor-dependent activation of phosphatidylinositol 4,5-diphosphate (PtdInsP2) 3-kinase.

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • nucleus Source: UniProtKB
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi21C → A: Loss of GTPase-activating activity. 1 Publication1
Mutagenesisi24C → A: Loss of GTPase-activating activity. 1 Publication1
Mutagenesisi149R → C: 40-45% reduction in PtdInsP2 3-kinase dependent membrane localization. Almost complete loss of PtdInsP2 3-kinase dependent membrane localization; when associated with C-273. 2 Publications1
Mutagenesisi273R → C: 70% reduction in PtdInsP2 3-kinase dependent membrane localization. Almost complete loss of PtdInsP2 3-kinase dependent membrane localization; when associated with C-149. 2 Publications1

Organism-specific databases

DisGeNETi11033.
OpenTargetsiENSG00000105963.
PharmGKBiPA26404.

Polymorphism and mutation databases

BioMutaiADAP1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000742051 – 374Arf-GAP with dual PH domain-containing protein 1Add BLAST374

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei87Phosphoserine; by PKC1 Publication1
Modified residuei272N6-acetyllysineCombined sources1
Modified residuei276Phosphothreonine; by PKC1 Publication1

Post-translational modificationi

Phosphorylated by PRKCA, PRKCI, PRKCZ and PRKD1 in vitro.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiO75689.
PaxDbiO75689.
PeptideAtlasiO75689.
PRIDEiO75689.

PTM databases

iPTMnetiO75689.
PhosphoSitePlusiO75689.

Expressioni

Tissue specificityi

Expressed at highest levels in brain and at lower levels in peripheral blood leukocytes.1 Publication

Gene expression databases

BgeeiENSG00000105963.
CleanExiHS_ADAP1.
ExpressionAtlasiO75689. baseline and differential.
GenevisibleiO75689. HS.

Organism-specific databases

HPAiHPA007033.
HPA012049.

Interactioni

Subunit structurei

Interacts with PRKCA, PRKCI and PRKCZ. Interacts with the N-terminal region of PRKD1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
DVL3Q929973EBI-714732,EBI-739789
GOLGA2Q083793EBI-714732,EBI-618309
SDCBP2Q9H1903EBI-714732,EBI-742426

Protein-protein interaction databases

BioGridi116222. 16 interactors.
DIPiDIP-41731N.
IntActiO75689. 8 interactors.
MINTiMINT-193767.
STRINGi9606.ENSP00000265846.

Structurei

Secondary structure

1374
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi3 – 12Combined sources10
Helixi16 – 18Combined sources3
Turni22 – 24Combined sources3
Beta strandi31 – 33Combined sources3
Turni34 – 37Combined sources4
Beta strandi38 – 40Combined sources3
Helixi42 – 49Combined sources8
Turni52 – 54Combined sources3
Beta strandi57 – 59Combined sources3
Turni60 – 62Combined sources3
Helixi67 – 75Combined sources9
Helixi78 – 85Combined sources8
Turni86 – 88Combined sources3
Helixi102 – 113Combined sources12
Turni117 – 119Combined sources3
Helixi121 – 124Combined sources4
Helixi125 – 128Combined sources4
Beta strandi129 – 139Combined sources11
Beta strandi141 – 143Combined sources3
Beta strandi146 – 154Combined sources9
Turni155 – 158Combined sources4
Beta strandi159 – 163Combined sources5
Beta strandi165 – 167Combined sources3
Beta strandi172 – 176Combined sources5
Helixi177 – 179Combined sources3
Beta strandi180 – 184Combined sources5
Helixi186 – 189Combined sources4
Beta strandi195 – 201Combined sources7
Beta strandi204 – 211Combined sources8
Helixi215 – 236Combined sources22
Beta strandi237 – 240Combined sources4
Helixi242 – 245Combined sources4
Helixi246 – 248Combined sources3
Beta strandi254 – 261Combined sources8
Beta strandi271 – 278Combined sources8
Beta strandi281 – 287Combined sources7
Beta strandi294 – 298Combined sources5
Helixi302 – 304Combined sources3
Beta strandi307 – 311Combined sources5
Beta strandi323 – 328Combined sources6
Beta strandi333 – 340Combined sources8
Helixi341 – 356Combined sources16
Helixi363 – 369Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3FEHX-ray1.90A3-370[»]
3FM8X-ray2.30C/D1-374[»]
3LJUX-ray1.70X3-370[»]
3MDBX-ray2.95C/D1-374[»]
ProteinModelPortaliO75689.
SMRiO75689.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75689.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini7 – 126Arf-GAPPROSITE-ProRule annotationAdd BLAST120
Domaini129 – 230PH 1PROSITE-ProRule annotationAdd BLAST102
Domaini252 – 356PH 2PROSITE-ProRule annotationAdd BLAST105

Sequence similaritiesi

Contains 1 Arf-GAP domain.PROSITE-ProRule annotation
Contains 2 PH domains.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri21 – 44C4-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0703. Eukaryota.
COG5347. LUCA.
GeneTreeiENSGT00860000133778.
HOGENOMiHOG000006719.
HOVERGENiHBG050888.
InParanoidiO75689.
OMAiVRLDAWD.
OrthoDBiEOG091G0789.
PhylomeDBiO75689.
TreeFamiTF324540.

Family and domain databases

Gene3Di2.30.29.30. 2 hits.
InterProiIPR001164. ArfGAP.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF01412. ArfGap. 1 hit.
PF00169. PH. 2 hits.
[Graphical view]
PRINTSiPR00405. REVINTRACTNG.
SMARTiSM00105. ArfGap. 1 hit.
SM00233. PH. 2 hits.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 2 hits.
PROSITEiPS50115. ARFGAP. 1 hit.
PS50003. PH_DOMAIN. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75689-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKERRRAVL ELLQRPGNAR CADCGAPDPD WASYTLGVFI CLSCSGIHRN
60 70 80 90 100
IPQVSKVKSV RLDAWEEAQV EFMASHGNDA ARARFESKVP SFYYRPTPSD
110 120 130 140 150
CQLLREQWIR AKYERQEFIY PEKQEPYSAG YREGFLWKRG RDNGQFLSRK
160 170 180 190 200
FVLTEREGAL KYFNRNDAKE PKAVMKIEHL NATFQPAKIG HPHGLQVTYL
210 220 230 240 250
KDNSTRNIFI YHEDGKEIVD WFNALRAARF HYLQVAFPGA GDADLVPKLS
260 270 280 290 300
RNYLKEGYME KTGPKQTEGF RKRWFTMDDR RLMYFKDPLD AFARGEVFIG
310 320 330 340 350
SKESGYTVLH GFPPSTQGHH WPHGITIVTP DRKFLFACET ESDQREWVAA
360 370
FQKAVDRPML PQEYAVEAHF KHKP
Length:374
Mass (Da):43,395
Last modified:November 25, 2008 - v2
Checksum:i38547281FB09D9B9
GO
Isoform 2 (identifier: O75689-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MAKERRRAVLELLQRPGNARCADCGAP → MFQFVFSRVYCINPARRKWKEFEKMLGCAEEGHASLGR

Show »
Length:385
Mass (Da):44,936
Checksum:i67ACBB2A85819D46
GO
Isoform 3 (identifier: O75689-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.

Show »
Length:302
Mass (Da):35,353
Checksum:i8197A42910488E1E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti215G → R in BAG52556 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_047470241G → S.4 PublicationsCorresponds to variant rs10256887dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0547931 – 72Missing in isoform 3. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_0547941 – 27MAKER…DCGAP → MFQFVFSRVYCINPARRKWK EFEKMLGCAEEGHASLGR in isoform 2. 1 PublicationAdd BLAST27

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006422 mRNA. Translation: CAA07024.1.
AF082324 mRNA. Translation: AAD11414.1.
AB097049 mRNA. Translation: BAC77402.1.
AK300999 mRNA. Translation: BAG62618.1.
AC073957 Genomic DNA. No translation available.
AK092471 mRNA. Translation: BAG52556.1.
CH236965 Genomic DNA. Translation: EAL23709.1.
CH471144 Genomic DNA. Translation: EAW87183.1.
CH471144 Genomic DNA. Translation: EAW87184.1.
BC033747 mRNA. Translation: AAH33747.1.
CCDSiCCDS5318.1. [O75689-1]
CCDS64576.1. [O75689-3]
CCDS64577.1. [O75689-2]
PIRiJC7091.
RefSeqiNP_001271237.1. NM_001284308.1.
NP_001271238.1. NM_001284309.1.
NP_001271239.1. NM_001284310.1.
NP_001271240.1. NM_001284311.1.
NP_006860.1. NM_006869.3.
UniGeneiHs.602573.

Genome annotation databases

EnsembliENST00000265846; ENSP00000265846; ENSG00000105963. [O75689-1]
ENST00000449296; ENSP00000407267; ENSG00000105963. [O75689-3]
ENST00000539900; ENSP00000442682; ENSG00000105963. [O75689-2]
ENST00000611167; ENSP00000481154; ENSG00000105963. [O75689-3]
GeneIDi11033.
KEGGihsa:11033.
UCSCiuc003sjn.5. human. [O75689-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006422 mRNA. Translation: CAA07024.1.
AF082324 mRNA. Translation: AAD11414.1.
AB097049 mRNA. Translation: BAC77402.1.
AK300999 mRNA. Translation: BAG62618.1.
AC073957 Genomic DNA. No translation available.
AK092471 mRNA. Translation: BAG52556.1.
CH236965 Genomic DNA. Translation: EAL23709.1.
CH471144 Genomic DNA. Translation: EAW87183.1.
CH471144 Genomic DNA. Translation: EAW87184.1.
BC033747 mRNA. Translation: AAH33747.1.
CCDSiCCDS5318.1. [O75689-1]
CCDS64576.1. [O75689-3]
CCDS64577.1. [O75689-2]
PIRiJC7091.
RefSeqiNP_001271237.1. NM_001284308.1.
NP_001271238.1. NM_001284309.1.
NP_001271239.1. NM_001284310.1.
NP_001271240.1. NM_001284311.1.
NP_006860.1. NM_006869.3.
UniGeneiHs.602573.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3FEHX-ray1.90A3-370[»]
3FM8X-ray2.30C/D1-374[»]
3LJUX-ray1.70X3-370[»]
3MDBX-ray2.95C/D1-374[»]
ProteinModelPortaliO75689.
SMRiO75689.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116222. 16 interactors.
DIPiDIP-41731N.
IntActiO75689. 8 interactors.
MINTiMINT-193767.
STRINGi9606.ENSP00000265846.

PTM databases

iPTMnetiO75689.
PhosphoSitePlusiO75689.

Polymorphism and mutation databases

BioMutaiADAP1.

Proteomic databases

MaxQBiO75689.
PaxDbiO75689.
PeptideAtlasiO75689.
PRIDEiO75689.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265846; ENSP00000265846; ENSG00000105963. [O75689-1]
ENST00000449296; ENSP00000407267; ENSG00000105963. [O75689-3]
ENST00000539900; ENSP00000442682; ENSG00000105963. [O75689-2]
ENST00000611167; ENSP00000481154; ENSG00000105963. [O75689-3]
GeneIDi11033.
KEGGihsa:11033.
UCSCiuc003sjn.5. human. [O75689-1]

Organism-specific databases

CTDi11033.
DisGeNETi11033.
GeneCardsiADAP1.
HGNCiHGNC:16486. ADAP1.
HPAiHPA007033.
HPA012049.
MIMi608114. gene.
neXtProtiNX_O75689.
OpenTargetsiENSG00000105963.
PharmGKBiPA26404.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0703. Eukaryota.
COG5347. LUCA.
GeneTreeiENSGT00860000133778.
HOGENOMiHOG000006719.
HOVERGENiHBG050888.
InParanoidiO75689.
OMAiVRLDAWD.
OrthoDBiEOG091G0789.
PhylomeDBiO75689.
TreeFamiTF324540.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000105963-MONOMER.
SIGNORiO75689.

Miscellaneous databases

ChiTaRSiADAP1. human.
EvolutionaryTraceiO75689.
GeneWikiiCentaurin,_alpha_1.
GenomeRNAii11033.
PROiO75689.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000105963.
CleanExiHS_ADAP1.
ExpressionAtlasiO75689. baseline and differential.
GenevisibleiO75689. HS.

Family and domain databases

Gene3Di2.30.29.30. 2 hits.
InterProiIPR001164. ArfGAP.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF01412. ArfGap. 1 hit.
PF00169. PH. 2 hits.
[Graphical view]
PRINTSiPR00405. REVINTRACTNG.
SMARTiSM00105. ArfGap. 1 hit.
SM00233. PH. 2 hits.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 2 hits.
PROSITEiPS50115. ARFGAP. 1 hit.
PS50003. PH_DOMAIN. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiADAP1_HUMAN
AccessioniPrimary (citable) accession number: O75689
Secondary accession number(s): A4D2Q2
, B3KRZ4, B4DVA6, F6XZ68, H7C2Q4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: November 25, 2008
Last modified: November 30, 2016
This is version 144 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.