Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Death effector domain-containing protein

Gene

DEDD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

A scaffold protein that directs CASP3 to certain substrates and facilitates their ordered degradation during apoptosis. May also play a role in mediating CASP3 cleavage of KRT18. Regulates degradation of intermediate filaments during apoptosis. May play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3. Inhibits DNA transcription in vitro (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding, Repressor
Biological processApoptosis, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Death effector domain-containing protein
Alternative name(s):
DEDPro1
Death effector domain-containing testicular molecule
FLDED-1
Gene namesi
Name:DEDD
Synonyms:DEDPRO1, DEFT
ORF Names:KE05
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000158796.16.
HGNCiHGNC:2755. DEDD.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi9191.
OpenTargetsiENSG00000158796.
PharmGKBiPA27236.

Polymorphism and mutation databases

BioMutaiDEDD.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001912741 – 318Death effector domain-containing proteinAdd BLAST318

Post-translational modificationi

Exists predominantly in a mono- or diubiquitinated form.

Keywords - PTMi

Ubl conjugation

Proteomic databases

MaxQBiO75618.
PaxDbiO75618.
PeptideAtlasiO75618.
PRIDEiO75618.

PTM databases

iPTMnetiO75618.
PhosphoSitePlusiO75618.

Expressioni

Tissue specificityi

Widely expressed with highest levels in testis.1 Publication

Gene expression databases

BgeeiENSG00000158796.
CleanExiHS_DEDD.
ExpressionAtlasiO75618. baseline and differential.
GenevisibleiO75618. HS.

Organism-specific databases

HPAiHPA030681.

Interactioni

Subunit structurei

Interacts with CASP8, CASP10, KRT8, KRT18, CASP3 and FADD. Homodimerizes and heterodimerizes with DEDD2.3 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi114627. 23 interactors.
DIPiDIP-41944N.
IntActiO75618. 17 interactors.
MINTiMINT-201863.
STRINGi9606.ENSP00000356985.

Structurei

3D structure databases

ProteinModelPortaliO75618.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 103DEDPROSITE-ProRule annotationAdd BLAST79

Phylogenomic databases

eggNOGiENOG410IFFJ. Eukaryota.
ENOG410Z8U6. LUCA.
GeneTreeiENSGT00390000008714.
HOGENOMiHOG000049120.
HOVERGENiHBG007220.
InParanoidiO75618.
PhylomeDBiO75618.
TreeFamiTF331807.

Family and domain databases

InterProiView protein in InterPro
IPR011029. DEATH-like_dom_sf.
IPR001875. DED_dom.
PfamiView protein in Pfam
PF01335. DED. 1 hit.
SMARTiView protein in SMART
SM00031. DED. 1 hit.
SUPFAMiSSF47986. SSF47986. 1 hit.
PROSITEiView protein in PROSITE
PS50168. DED. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75618-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGLKRRASQ VWPEEHGEQE HGLYSLHRMF DIVGTHLTHR DVRVLSFLFV
60 70 80 90 100
DVIDDHERGL IRNGRDFLLA LERQGRCDES NFRQVLQLLR IITRHDLLPY
110 120 130 140 150
VTLKRRRAVC PDLVDKYLEE TSIRYVTPRA LSDPEPRPPQ PSKTVPPHYP
160 170 180 190 200
VVCCPTSGPQ MCSKRPARGR ATLGSQRKRR KSVTPDPKEK QTCDIRLRVR
210 220 230 240 250
AEYCQHETAL QGNVFSNKQD PLERQFERFN QANTILKSRD LGSIICDIKF
260 270 280 290 300
SELTYLDAFW RDYINGSLLE ALKGVFITDS LKQAVGHEAI KLLVNVDEED
310
YELGRQKLLR NLMLQALP
Length:318
Mass (Da):36,794
Last modified:November 1, 1998 - v1
Checksum:iFF9D5FF9B61F6BB6
GO
Isoform 2 (identifier: O75618-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     194-194: D → GEEIQGFQRWSRLEGEYKELLGHWAVYAIQY

Note: No experimental confirmation available.
Show »
Length:348
Mass (Da):40,418
Checksum:i7E40585470706387
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_003846194D → GEEIQGFQRWSRLEGEYKEL LGHWAVYAIQY in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083236 mRNA. Translation: AAC33105.1.
AF100341 mRNA. Translation: AAD16414.1.
AF043733 mRNA. Translation: AAC80280.1.
AJ010973 mRNA. Translation: CAA09445.1.
AF064605 mRNA. Translation: AAC17110.3.
CR536556 mRNA. Translation: CAG38793.1.
AL591806 Genomic DNA. Translation: CAI15381.1.
CH471121 Genomic DNA. Translation: EAW52648.1.
CH471121 Genomic DNA. Translation: EAW52650.1.
CH471121 Genomic DNA. Translation: EAW52651.1.
CH471121 Genomic DNA. Translation: EAW52652.1.
CH471121 Genomic DNA. Translation: EAW52653.1.
BC016724 mRNA. Translation: AAH16724.1.
BC013910 mRNA. Translation: AAH13910.1.
CCDSiCCDS1219.1. [O75618-1]
CCDS81391.1. [O75618-2]
RefSeqiNP_001034800.1. NM_001039711.1. [O75618-1]
NP_001034801.1. NM_001039712.1. [O75618-1]
NP_127491.1. NM_032998.2. [O75618-1]
XP_016858291.1. XM_017002802.1. [O75618-1]
UniGeneiHs.744092.

Genome annotation databases

EnsembliENST00000368006; ENSP00000356985; ENSG00000158796. [O75618-1]
ENST00000458050; ENSP00000414821; ENSG00000158796. [O75618-1]
ENST00000490843; ENSP00000476946; ENSG00000158796. [O75618-1]
ENST00000545495; ENSP00000445835; ENSG00000158796. [O75618-1]
GeneIDi9191.
KEGGihsa:9191.
UCSCiuc001fxz.5. human. [O75618-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDEDD_HUMAN
AccessioniPrimary (citable) accession number: O75618
Secondary accession number(s): D3DVF5, O60737
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2002
Last sequence update: November 1, 1998
Last modified: November 22, 2017
This is version 150 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot