O75618 (DEDD_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Death effector domain-containing protein Alternative name(s): DEDPro1 Death effector domain-containing testicular molecule FLDED-1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 318 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | A scaffold protein that directs CASP3 to certain substrates and facilitates their ordered degradation during apoptosis. May also play a role in mediating CASP3 cleavage of KRT18. Regulates degradation of intermediate filaments during apoptosis. May play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3. Inhibits DNA transcription in vitro By similarity. Ref.10 |
| Subunit structure | Interacts with CASP8, CASP10, KRT8, KRT18, CASP3 and FADD. Homodimerizes and heterodimerizes with DEDD2. Ref.10 Ref.11 Ref.12 |
| Subcellular location | Cytoplasm. Nucleus › nucleolus By similarity. Note: Translocated to the nucleus during CD95-mediated apoptosis where it is localized in the nucleoli By similarity. Following apoptosis induction, the mono and/or diubiquitination form increases and forms filamentous structures that colocalize with KRT8 and KRT18 intermediate filament network in simple epithelial cells. |
| Tissue specificity | Widely expressed with highest levels in testis. Ref.2 |
| Post-translational modification | Exists predominantly in a mono- or diubiquitinated form. |
| Sequence similarities | Contains 1 DED (death effector) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| APLP2 | Q06481 | 3 | EBI-1043164,EBI-79306 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75618-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75618-2) The sequence of this isoform differs from the canonical sequence as follows: 194-194: D → GEEIQGFQRWSRLEGEYKELLGHWAVYAIQY | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "DEDD, a novel death effector domain-containing protein, targeted to the nucleolus." Stegh A.H., Schickling O., Ehret A., Scaffidi C., Peterhaensel C., Hofmann T.G., Grummt I., Krammer P.H., Peter M.E. EMBO J. 17:5974-5986(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "DEFT, a novel death effector domain-containing molecule predominantly expressed in testicular germ cells." Leo C.P., Hsu S.Y., McGee E.A., Salanova M., Hsueh A.J.W. Endocrinology 139:4839-4848(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Testis. |
| [3] | "FLDED-1, a novel molecule with a DED-like domain." Pan G. Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "DEDPRO1, a novel DED-containing protein." Thome M., Tschopp J. Submitted (OCT-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [5] | "A novel gene from human dendritic cell." Zhao Z., Huang X., Li N., Zhu X., Cao X. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Dendritic cell. |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow and Placenta. |
| [10] | "DEDD regulates degradation of intermediate filaments during apoptosis." Lee J.C., Schickling O., Stegh A.H., Oshima R.G., Dinsdale D., Cohen G.M., Peter M.E. J. Cell Biol. 158:1051-1066(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH KRT8; KRT18 AND CASP3. |
| [11] | "Death effector domain-containing proteins DEDD and FLAME-3 form nuclear complexes with the TFIIIC102 subunit of human transcription factor IIIC." Zhan Y., Hegde R., Srinivasula S.M., Fernandes-Alnemri T., Alnemri E.S. Cell Death Differ. 9:439-447(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GTF3C3. |
| [12] | "DEDD and DEDD2 associate with caspase-8/10 and signal cell death." Alcivar A., Hu S., Tang J., Yang X. Oncogene 22:291-297(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CASP8 AND CASP10. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF083236 mRNA. Translation: AAC33105.1. AF100341 mRNA. Translation: AAD16414.1. AF043733 mRNA. Translation: AAC80280.1. AJ010973 mRNA. Translation: CAA09445.1. AF064605 mRNA. Translation: AAC17110.3. CR536556 mRNA. Translation: CAG38793.1. AL591806 Genomic DNA. Translation: CAI15381.1. CH471121 Genomic DNA. Translation: EAW52648.1. CH471121 Genomic DNA. Translation: EAW52650.1. CH471121 Genomic DNA. Translation: EAW52651.1. CH471121 Genomic DNA. Translation: EAW52652.1. CH471121 Genomic DNA. Translation: EAW52653.1. BC016724 mRNA. Translation: AAH16724.1. BC013910 mRNA. Translation: AAH13910.1. |
| IPI | IPI00004539. IPI00216748. |
| RefSeq | NP_001034800.1. NM_001039711.1. NP_001034801.1. NM_001039712.1. NP_127491.1. NM_032998.2. |
| UniGene | Hs.744092. |
3D structure databases | |
| ProteinModelPortal | O75618. |
| SMR | O75618. Positions 29-101. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O75618. 14 interactions. |
| MINT | MINT-201863. |
| STRING | 9606.ENSP00000356985. |
PTM databases | |
| PhosphoSite | O75618. |
Proteomic databases | |
| PaxDb | O75618. |
| PRIDE | O75618. |
Protocols and materials databases | |
| DNASU | 9191. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000368006; ENSP00000356985; ENSG00000158796. ENST00000458050; ENSP00000414821; ENSG00000158796. ENST00000541906; ENSP00000442587; ENSG00000158796. ENST00000545495; ENSP00000445835; ENSG00000158796. |
| GeneID | 9191. |
| KEGG | hsa:9191. |
| UCSC | uc001fxz.3. human. |
Organism-specific databases | |
| CTD | 9191. |
| GeneCards | GC01M161090. |
| HGNC | HGNC:2755. DEDD. |
| MIM | 606841. gene. |
| neXtProt | NX_O75618. |
| PharmGKB | PA27236. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG40331. |
| HOGENOM | HOG000049120. |
| HOVERGEN | HBG007220. |
| OrthoDB | EOG466VM6. |
| PhylomeDB | O75618. |
Gene expression databases | |
| ArrayExpress | O75618. |
| Bgee | O75618. |
| CleanEx | HS_DEDD. |
| Genevestigator | O75618. |
| GermOnline | ENSG00000158796. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.533.10. 1 hit. |
| InterPro | IPR011029. DEATH-like_dom. IPR001875. DED. [Graphical view] |
| Pfam | PF01335. DED. 1 hit. [Graphical view] |
| SMART | SM00031. DED. 1 hit. [Graphical view] |
| SUPFAM | SSF47986. DEATH_like. 1 hit. |
| PROSITE | PS50168. DED. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 9191. |
| NextBio | 34461. |
| SOURCE | Search... |
Entry information
| Entry name | DEDD_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75618 Secondary accession number(s): D3DVF5, O60737 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
